PAAF1 (proteasomal ATPase associated factor 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80227
• Gene name: Proteasomal ATPase associated factor 1
• Gene symbol: PAAF1
• Synonyms (NCBI Gene): PAAF, Rpn14, WDR71
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: This gene encodes a WD repeat-containing protein involved in regulation of association of proteasome components. During HIV infection, the encoded protein is thought to promote provirus transcription through recruitment of the 19S regulatory complex. Alte

miRNA Show/Hide all (67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032270	hsa-let-7b-5p	Proteomics	18668040
MIRT1209365	hsa-miR-105	CLIP-seq
MIRT1209366	hsa-miR-1278	CLIP-seq
MIRT1209367	hsa-miR-1323	CLIP-seq
MIRT1209368	hsa-miR-299-5p	CLIP-seq
MIRT1209369	hsa-miR-300	CLIP-seq
MIRT1209370	hsa-miR-30a	CLIP-seq
MIRT1209371	hsa-miR-30b	CLIP-seq
MIRT1209372	hsa-miR-30c	CLIP-seq
MIRT1209373	hsa-miR-30d	CLIP-seq
MIRT1209374	hsa-miR-30e	CLIP-seq
MIRT1209375	hsa-miR-342-5p	CLIP-seq
MIRT1209376	hsa-miR-3653	CLIP-seq
MIRT1209377	hsa-miR-3658	CLIP-seq
MIRT1209378	hsa-miR-381	CLIP-seq
MIRT1209379	hsa-miR-4428	CLIP-seq
MIRT1209380	hsa-miR-4434	CLIP-seq
MIRT1209381	hsa-miR-4511	CLIP-seq
MIRT1209382	hsa-miR-4516	CLIP-seq
MIRT1209383	hsa-miR-4651	CLIP-seq
MIRT1209384	hsa-miR-4664-5p	CLIP-seq
MIRT1209385	hsa-miR-4666-3p	CLIP-seq
MIRT1209386	hsa-miR-4731-5p	CLIP-seq
MIRT1209387	hsa-miR-4789-5p	CLIP-seq
MIRT1209388	hsa-miR-495	CLIP-seq
MIRT1209389	hsa-miR-548a-3p	CLIP-seq
MIRT1209390	hsa-miR-548b-3p	CLIP-seq
MIRT1209391	hsa-miR-548e	CLIP-seq
MIRT1209392	hsa-miR-548f	CLIP-seq
MIRT1209393	hsa-miR-548o	CLIP-seq
MIRT1209394	hsa-miR-582-3p	CLIP-seq
MIRT1209395	hsa-miR-608	CLIP-seq
MIRT1209396	hsa-miR-624	CLIP-seq
MIRT2288485	hsa-miR-1238	CLIP-seq
MIRT1209366	hsa-miR-1278	CLIP-seq
MIRT1209367	hsa-miR-1323	CLIP-seq
MIRT1209368	hsa-miR-299-5p	CLIP-seq
MIRT1209370	hsa-miR-30a	CLIP-seq
MIRT1209371	hsa-miR-30b	CLIP-seq
MIRT1209372	hsa-miR-30c	CLIP-seq
MIRT1209373	hsa-miR-30d	CLIP-seq
MIRT1209374	hsa-miR-30e	CLIP-seq
MIRT1209376	hsa-miR-3653	CLIP-seq
MIRT1209377	hsa-miR-3658	CLIP-seq
MIRT2288486	hsa-miR-3919	CLIP-seq
MIRT2288487	hsa-miR-3925-5p	CLIP-seq
MIRT2288488	hsa-miR-4422	CLIP-seq
MIRT2288489	hsa-miR-4438	CLIP-seq
MIRT1209381	hsa-miR-4511	CLIP-seq
MIRT2288490	hsa-miR-4652-3p	CLIP-seq
MIRT2288491	hsa-miR-4677-3p	CLIP-seq
MIRT2288492	hsa-miR-4679	CLIP-seq
MIRT2288493	hsa-miR-4691-5p	CLIP-seq
MIRT2288494	hsa-miR-4693-3p	CLIP-seq
MIRT2288495	hsa-miR-4712-3p	CLIP-seq
MIRT2288496	hsa-miR-4712-5p	CLIP-seq
MIRT2288497	hsa-miR-4773	CLIP-seq
MIRT1209388	hsa-miR-495	CLIP-seq
MIRT2288498	hsa-miR-520a-5p	CLIP-seq
MIRT2288499	hsa-miR-525-5p	CLIP-seq
MIRT1209389	hsa-miR-548a-3p	CLIP-seq
MIRT1209390	hsa-miR-548b-3p	CLIP-seq
MIRT1209391	hsa-miR-548e	CLIP-seq
MIRT1209392	hsa-miR-548f	CLIP-seq
MIRT1209393	hsa-miR-548o	CLIP-seq
MIRT1209394	hsa-miR-582-3p	CLIP-seq
MIRT2288500	hsa-miR-770-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IBA
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0005515	Function	Protein binding	IPI	19490896, 33961781, 35271311
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS

Other IDs

• MIM: 619772
• HGNC: 25687
• e!Ensembl: ENSG00000175575

Protein

• UniProt ID: Q9BRP4
• Protein name: Proteasomal ATPase-associated factor 1 (Protein G-16) (WD repeat-containing protein 71)
• Protein function: Inhibits proteasome 26S assembly and proteolytic activity by impairing the association of the 19S regulatory complex with the 20S core. In case of HIV-1 infection, recruited by viral Tat to the HIV-1 promoter, where it promotes the recruitment o
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	124 → 162	WD domain, G-beta repeat	Repeat
  PF00400	WD40	166 → 204	WD domain, G-beta repeat	Repeat
  PF00400	WD40	82 → 120	WD domain, G-beta repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in kidney, brain and testis. {ECO:0000269|PubMed:15831487}.
• Sequence:

  MAAPLRIQSDWAQALRKDEGEAWLSCHPPGKPSLYGSLTCQGIGLDGIPEVTASEGFTVN
  EINKKSIHISCPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGLGVSSSTDGTMKIWQ
  ASNGELRRVLEGHVFDVNCCRFFPSGLVVLSGGMDAQLKIWSAEDASCVVTFKGHKGGIL
  DTAIVDRGRNVVSASRDGTARLWDCGRSACLGVLADCGSSINGVAVGAADNSINLGSPEQ
  MPSEREVGTEAKMLLLAREDKKLQCLGLQSRQLVFLFIGSDAFNCCTFLSGFLLLAGTQD
  GNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGA
  DCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL

• Sequence length: 392

Related Genes

No strongly related genes found yet for PAAF1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to PAAF1.