P3R3URF (PIK3R3 upstream open reading frame)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 110117498 |
| Gene name | PIK3R3 upstream open reading frame |
| Gene symbol | P3R3URF |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 1 |
| Chromosome location | 1p34.1 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A087WWA1 |
| Protein name | PIK3R3 upstream open reading frame protein |
| Family and domains | |
| Sequence |
MGPSRLVRGPRPQGMRSPYRRPGMGWPRPRFPRMFKCSRRRYQQGLRGRTASSAAINPAT |
| Sequence length | 95 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with P3R3URF across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to P3R3URF (see Related Genes above), that are NOT already directly curated for P3R3URF itself -- a lead worth checking, not a confirmed association.
0
|
|