Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	286530
Gene name	P2Y receptor family member 8
Gene symbol	P2RY8
Synonyms (NCBI Gene)	P2Y8
Chromosome	X\|Y
Chromosome location	X;Y
Summary	The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene is moderately expressed in undifferentiated HL60 cells, and is located on both chromos

SNP ID	Visualize variation	Clinical significance	Consequence
rs1603452612	G>C	Likely-pathogenic	Coding sequence variant, missense variant

75 Show/Hide all (75)

miRTarBase ID	miRNA	Experiments
MIRT1209103	hsa-miR-103a	CLIP-seq
MIRT1209104	hsa-miR-107	CLIP-seq
MIRT1209105	hsa-miR-3150b-3p	CLIP-seq
MIRT1209106	hsa-miR-324-5p	CLIP-seq
MIRT1209107	hsa-miR-331-3p	CLIP-seq
MIRT1209108	hsa-miR-378g	CLIP-seq
MIRT1209109	hsa-miR-4254	CLIP-seq
MIRT1209110	hsa-miR-4260	CLIP-seq
MIRT1209111	hsa-miR-4292	CLIP-seq
MIRT1209112	hsa-miR-4308	CLIP-seq
MIRT1209113	hsa-miR-4434	CLIP-seq
MIRT1209114	hsa-miR-4480	CLIP-seq
MIRT1209115	hsa-miR-4493	CLIP-seq
MIRT1209116	hsa-miR-4516	CLIP-seq
MIRT1209117	hsa-miR-4531	CLIP-seq
MIRT1209118	hsa-miR-4716-5p	CLIP-seq
MIRT1209119	hsa-miR-4722-3p	CLIP-seq
MIRT1209120	hsa-miR-4753-5p	CLIP-seq
MIRT1209121	hsa-miR-4773	CLIP-seq
MIRT1209122	hsa-miR-4784	CLIP-seq
MIRT1209123	hsa-miR-486-3p	CLIP-seq
MIRT1209124	hsa-miR-765	CLIP-seq
MIRT2060061	hsa-miR-1253	CLIP-seq
MIRT2060062	hsa-miR-214	CLIP-seq
MIRT2060063	hsa-miR-3619-5p	CLIP-seq
MIRT2060064	hsa-miR-3675-5p	CLIP-seq
MIRT2060065	hsa-miR-3925-3p	CLIP-seq
MIRT1209109	hsa-miR-4254	CLIP-seq
MIRT2060066	hsa-miR-4270	CLIP-seq
MIRT2060067	hsa-miR-4283	CLIP-seq
MIRT1209113	hsa-miR-4434	CLIP-seq
MIRT2060068	hsa-miR-4441	CLIP-seq
MIRT2060069	hsa-miR-4487	CLIP-seq
MIRT2060070	hsa-miR-4489	CLIP-seq
MIRT1209116	hsa-miR-4516	CLIP-seq
MIRT2060071	hsa-miR-4646-5p	CLIP-seq
MIRT2060072	hsa-miR-548c-3p	CLIP-seq
MIRT2060073	hsa-miR-761	CLIP-seq
MIRT2060061	hsa-miR-1253	CLIP-seq
MIRT2060064	hsa-miR-3675-5p	CLIP-seq
MIRT2288417	hsa-miR-3922-5p	CLIP-seq
MIRT2060067	hsa-miR-4283	CLIP-seq
MIRT1209113	hsa-miR-4434	CLIP-seq
MIRT2060069	hsa-miR-4487	CLIP-seq
MIRT2060070	hsa-miR-4489	CLIP-seq
MIRT1209116	hsa-miR-4516	CLIP-seq
MIRT2060071	hsa-miR-4646-5p	CLIP-seq
MIRT2288418	hsa-miR-4667-5p	CLIP-seq
MIRT2288419	hsa-miR-4700-5p	CLIP-seq
MIRT2288420	hsa-miR-508-5p	CLIP-seq
MIRT2288421	hsa-miR-574-3p	CLIP-seq
MIRT2392034	hsa-miR-3182	CLIP-seq
MIRT2060069	hsa-miR-4487	CLIP-seq
MIRT1209105	hsa-miR-3150b-3p	CLIP-seq
MIRT1209107	hsa-miR-331-3p	CLIP-seq
MIRT1209109	hsa-miR-4254	CLIP-seq
MIRT1209112	hsa-miR-4308	CLIP-seq
MIRT1209113	hsa-miR-4434	CLIP-seq
MIRT1209115	hsa-miR-4493	CLIP-seq
MIRT1209116	hsa-miR-4516	CLIP-seq
MIRT1209117	hsa-miR-4531	CLIP-seq
MIRT1209120	hsa-miR-4753-5p	CLIP-seq
MIRT1209122	hsa-miR-4784	CLIP-seq
MIRT1209124	hsa-miR-765	CLIP-seq
MIRT1209105	hsa-miR-3150b-3p	CLIP-seq
MIRT1209107	hsa-miR-331-3p	CLIP-seq
MIRT1209109	hsa-miR-4254	CLIP-seq
MIRT1209112	hsa-miR-4308	CLIP-seq
MIRT1209113	hsa-miR-4434	CLIP-seq
MIRT1209115	hsa-miR-4493	CLIP-seq
MIRT1209116	hsa-miR-4516	CLIP-seq
MIRT1209117	hsa-miR-4531	CLIP-seq
MIRT1209120	hsa-miR-4753-5p	CLIP-seq
MIRT1209122	hsa-miR-4784	CLIP-seq
MIRT1209124	hsa-miR-765	CLIP-seq

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	25274307
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25274307
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007266	Process	Rho protein signal transduction	IDA	26529257
GO:0007266	Process	Rho protein signal transduction	IMP	23241886, 31570889
GO:0016020	Component	Membrane	IEA
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IEA
GO:0160221	Process	Rho-activating G protein-coupled receptor signaling pathway	IDA	10199825, 11094164
GO:0160221	Process	Rho-activating G protein-coupled receptor signaling pathway	IDA	25274307

MIM	HGNC	e!Ensembl
300525	15524	ENSG00000182162

Q86VZ1

Protein name

S-geranylgeranyl-glutathione receptor P2RY8 (P2Y purinoceptor 8) (P2Y8)

Protein function

G protein-coupled receptor for S-geranylgeranyl-glutathione (GGG), an endogenous metabolite present in lymphoid tissues. Couples the binding of GGG to the activation of GNA13 and downstream repression of AKT activation in lymphocytes defining th

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	40 → 293	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Barely detectable in normal blood leukocytes. Weaker expression was seen in heart, kidney and lung. Not detected in brain (PubMed:11004484, PubMed:15466006). Expressed in B cells and follicular helper T cells in germinal centers (at pr

Sequence

MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVI
FMINLSVTDLMLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVE
RFLGVLYPLSSKRWRRRRYAVAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLK
WTMLPSVAMWAVFLFTIFILLFLIPFVITVACYTATILKLLRTEEAHGREQRRRAVGLAA
VVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREF
QLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF

Sequence length

359

Interactions

View interactions

KEGG Pathway
Neuroactive ligand-receptor interaction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Multiple myeloma	Likely pathogenic	rs1603452612	RCV000984127	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (24)
Acute leukemia	Leukemia	BEFREE	17487742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19838194, 22368272, 22484421, 27899802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19838194, 22368272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	30842656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36360294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	40650227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	19838194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19838194, 22368272, 23091296, 27899802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	40650227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	19838194, 22484421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	25880808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	15466006		★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	19838194		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17487742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34901992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	27959929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	17554380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25274307, 30842656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	15466006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	BEFREE	29140408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	20378752, 27637012, 29982439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	19838194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	22484421, 27899802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	40650227	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with P2RY8 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for P2RY8.

Diseases Linked via Similar Genes Diseases curated for genes most similar to P2RY8 (see Related Genes above), that are NOT already directly curated for P2RY8 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to P2RY8.

P2RY8 (P2Y receptor family member 8)

Save This Analysis