Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5024
Gene name	Purinergic receptor P2X 3
Gene symbol	P2RX3
Synonyms (NCBI Gene)	P2X3
Chromosome	11
Chromosome location	11q12.1
Summary	This gene encodes a member of the P2X purinergic receptor (purinoceptor) gene family which includes seven members (P2RX1 - P2RX7). P2X purinoceptors are a family of cation-permeable, ligand-gated ion channels that open in response to the binding of extrac

28 Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT573189	hsa-miR-3126-3p	PAR-CLIP	20371350
MIRT573188	hsa-miR-1298-3p	PAR-CLIP	20371350
MIRT573187	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT573186	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT573185	hsa-miR-8073	PAR-CLIP	20371350
MIRT573184	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT573183	hsa-miR-342-3p	PAR-CLIP	20371350
MIRT573182	hsa-miR-3190-5p	PAR-CLIP	20371350
MIRT573180	hsa-miR-3176	PAR-CLIP	20371350
MIRT573181	hsa-miR-3922-3p	PAR-CLIP	20371350
MIRT573179	hsa-miR-4794	PAR-CLIP	20371350
MIRT573178	hsa-miR-664a-5p	PAR-CLIP	20371350
MIRT573177	hsa-miR-661	PAR-CLIP	20371350
MIRT573176	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT573189	hsa-miR-3126-3p	PAR-CLIP	20371350
MIRT573188	hsa-miR-1298-3p	PAR-CLIP	20371350
MIRT573187	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT573186	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT573185	hsa-miR-8073	PAR-CLIP	20371350
MIRT573184	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT573183	hsa-miR-342-3p	PAR-CLIP	20371350
MIRT573182	hsa-miR-3190-5p	PAR-CLIP	20371350
MIRT573180	hsa-miR-3176	PAR-CLIP	20371350
MIRT573181	hsa-miR-3922-3p	PAR-CLIP	20371350
MIRT573179	hsa-miR-4794	PAR-CLIP	20371350
MIRT573178	hsa-miR-664a-5p	PAR-CLIP	20371350
MIRT573177	hsa-miR-661	PAR-CLIP	20371350
MIRT573176	hsa-miR-6735-3p	PAR-CLIP	20371350

57 Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001614	Function	Purinergic nucleotide receptor activity	IDA	27626375
GO:0001614	Function	Purinergic nucleotide receptor activity	IEA
GO:0001614	Function	Purinergic nucleotide receptor activity	NAS	17895406
GO:0001666	Process	Response to hypoxia	IEA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IBA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IDA	10440098, 27626375
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	IEA
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	NAS	17895406
GO:0004931	Function	Extracellularly ATP-gated monoatomic cation channel activity	TAS	9221902
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005524	Function	ATP binding	IDA	27626375
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS	17895406
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	27626375
GO:0005886	Component	Plasma membrane	TAS	9221902
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0007165	Process	Signal transduction	TAS	9221902
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007274	Process	Neuromuscular synaptic transmission	IEA
GO:0009266	Process	Response to temperature stimulus	IEA
GO:0009408	Process	Response to heat	IEA
GO:0009409	Process	Response to cold	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009743	Process	Response to carbohydrate	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	NAS	17895406
GO:0014832	Process	Urinary bladder smooth muscle contraction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0030432	Process	Peristalsis	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0033198	Process	Response to ATP	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0035590	Process	Purinergic nucleotide receptor signaling pathway	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0046872	Function	Metal ion binding	IEA
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048266	Process	Behavioral response to pain	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	NAS	17895406
GO:0050909	Process	Sensory perception of taste	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0070207	Process	Protein homotrimerization	IDA	27626375
GO:0070588	Process	Calcium ion transmembrane transport	IBA
GO:0070588	Process	Calcium ion transmembrane transport	IDA	10440098
GO:0071318	Process	Cellular response to ATP	IDA	27626375
GO:0098655	Process	Monoatomic cation transmembrane transport	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	27626375
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098794	Component	Postsynapse	IEA

MIM	HGNC	e!Ensembl
600843	8534	ENSG00000109991

P56373

Protein name

P2X purinoceptor 3 (P2X3) (ATP receptor) (Purinergic receptor)

Protein function

Extracellular ATP-activated non-selective cation channel (PubMed:10440098, PubMed:27626375, PubMed:29674445, PubMed:31232692). Plays particularly important role in sensory neurons where its activation is critical for gustatory, nociceptive respo

PDB

5SVJ , 5SVK , 5SVL , 5SVM , 5SVP , 5SVQ , 5SVR , 5SVS , 5SVT , 5YVE , 6AH4 , 6AH5 , 9IK1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00864	P2X_receptor	8 → 365		Family

Sequence

MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDS
QCGPERLPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVETPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEE
VNETTLKIAALTNPVYPSDQTTAEKQSTDSGAFSIGH

Sequence length

397

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Calcium signaling pathway	Elevation of cytosolic Ca2+ levels
Neuroactive ligand-receptor interaction	Platelet homeostasis
Taste transduction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
HEART VALVE DISEASE	—	GWAS catalog	34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	19383439	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	33495597	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (72)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17990272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27355755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	27709491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30996785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27355755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Polycystic Kidney Disease	Polycystic kidney disease	BEFREE	15325248, 30417216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18543274, 18614336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21157381, 28536012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27993161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31401785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	25029427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26541524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	14701827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23602648, 27658510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26686228, 30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28840511, 29210478, 30544633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	30084084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25029427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25029427, 28898282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	22836594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29270247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	24703484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28840058, 31152337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30821687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28735873, 28993732, 29311923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28797095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29674445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28840058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31202513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29021225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26517690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28415591, 28878780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	31726893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26491047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20493226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18543274, 23602648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	23707265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30762755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25515510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23602648, 27658510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	27658510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	18268501, 29122639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29341465, 30908981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1649238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	21170044, 23497937, 23725858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21157381, 23707265, 30006588, 30209547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21081501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31054067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30196147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28298636, 30103845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27658510, 29692728, 31054067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30103845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30084084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	30084084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	27781340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28415591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20493226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18614336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25318479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28430665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29749377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28710025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	30010623		★★★★★ ★☆☆☆☆ Found in Text Mining only

P2RX3 (purinergic receptor P2X 3)

Bookmark This Gene