OTUD6A (OTU deubiquitinase 6A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 139562
• Gene name: OTU deubiquitinase 6A
• Gene symbol: OTUD6A
• Synonyms (NCBI Gene): DUBA2, HSHIN6
• Chromosome: X
• Chromosome location: Xq13.1
• Summary: Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA2 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.[supplied by

miRNA Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049350	hsa-miR-92a-3p	CLASH	23622248
MIRT517210	hsa-miR-4781-3p	PAR-CLIP	23446348
MIRT517209	hsa-miR-4716-5p	PAR-CLIP	23446348
MIRT517208	hsa-miR-6134	PAR-CLIP	23446348
MIRT517207	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT517206	hsa-miR-92a-2-5p	PAR-CLIP	23446348
MIRT517205	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT517204	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT517203	hsa-miR-6742-5p	PAR-CLIP	23446348
MIRT517202	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT517201	hsa-miR-548s	PAR-CLIP	23446348
MIRT517200	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT517199	hsa-miR-588	PAR-CLIP	23446348
MIRT517198	hsa-miR-4435	PAR-CLIP	23446348
MIRT517197	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT517196	hsa-miR-3170	PAR-CLIP	23446348
MIRT517195	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT517194	hsa-miR-3674	PAR-CLIP	23446348
MIRT517193	hsa-miR-3149	PAR-CLIP	23446348
MIRT517192	hsa-miR-5096	PAR-CLIP	23446348
MIRT517191	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT517210	hsa-miR-4781-3p	PAR-CLIP	23446348
MIRT517209	hsa-miR-4716-5p	PAR-CLIP	23446348
MIRT517208	hsa-miR-6134	PAR-CLIP	23446348
MIRT517207	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT517206	hsa-miR-92a-2-5p	PAR-CLIP	23446348
MIRT517205	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT517204	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT517203	hsa-miR-6742-5p	PAR-CLIP	23446348
MIRT517202	hsa-miR-197-3p	PAR-CLIP	23446348
MIRT517201	hsa-miR-548s	PAR-CLIP	23446348
MIRT517200	hsa-miR-4701-5p	PAR-CLIP	23446348
MIRT517199	hsa-miR-588	PAR-CLIP	23446348
MIRT517198	hsa-miR-4435	PAR-CLIP	23446348
MIRT517197	hsa-miR-3187-3p	PAR-CLIP	23446348
MIRT517196	hsa-miR-3170	PAR-CLIP	23446348
MIRT517195	hsa-miR-6855-5p	PAR-CLIP	23446348
MIRT517194	hsa-miR-3674	PAR-CLIP	23446348
MIRT517193	hsa-miR-3149	PAR-CLIP	23446348
MIRT517192	hsa-miR-5096	PAR-CLIP	23446348
MIRT517191	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT1207986	hsa-miR-1184	CLIP-seq
MIRT1207987	hsa-miR-1281	CLIP-seq
MIRT1207988	hsa-miR-1321	CLIP-seq
MIRT1207989	hsa-miR-197	CLIP-seq
MIRT1207990	hsa-miR-3126-5p	CLIP-seq
MIRT1207991	hsa-miR-3159	CLIP-seq
MIRT1207992	hsa-miR-3663-5p	CLIP-seq
MIRT1207993	hsa-miR-4258	CLIP-seq
MIRT1207994	hsa-miR-4259	CLIP-seq
MIRT1207995	hsa-miR-4418	CLIP-seq
MIRT1207996	hsa-miR-4419a	CLIP-seq
MIRT1207997	hsa-miR-4438	CLIP-seq
MIRT1207998	hsa-miR-4454	CLIP-seq
MIRT1207999	hsa-miR-4510	CLIP-seq
MIRT1208000	hsa-miR-4532	CLIP-seq
MIRT1208001	hsa-miR-4707-3p	CLIP-seq
MIRT1208002	hsa-miR-4710	CLIP-seq
MIRT1208003	hsa-miR-4715-5p	CLIP-seq
MIRT1208004	hsa-miR-4739	CLIP-seq
MIRT1208005	hsa-miR-4755-3p	CLIP-seq
MIRT1208006	hsa-miR-4756-5p	CLIP-seq
MIRT1208007	hsa-miR-4792	CLIP-seq
MIRT1208008	hsa-miR-509-3-5p	CLIP-seq
MIRT1208009	hsa-miR-5095	CLIP-seq
MIRT1208010	hsa-miR-509-5p	CLIP-seq
MIRT1207986	hsa-miR-1184	CLIP-seq
MIRT1207987	hsa-miR-1281	CLIP-seq
MIRT2059763	hsa-miR-1976	CLIP-seq
MIRT1207992	hsa-miR-3663-5p	CLIP-seq
MIRT2059764	hsa-miR-4279	CLIP-seq
MIRT1207995	hsa-miR-4418	CLIP-seq
MIRT1207998	hsa-miR-4454	CLIP-seq
MIRT1208000	hsa-miR-4532	CLIP-seq
MIRT1208001	hsa-miR-4707-3p	CLIP-seq
MIRT2059765	hsa-miR-4722-3p	CLIP-seq
MIRT1208005	hsa-miR-4755-3p	CLIP-seq
MIRT1208008	hsa-miR-509-3-5p	CLIP-seq
MIRT1208010	hsa-miR-509-5p	CLIP-seq
MIRT1207986	hsa-miR-1184	CLIP-seq
MIRT2288103	hsa-miR-122	CLIP-seq
MIRT2288104	hsa-miR-1287	CLIP-seq
MIRT1207989	hsa-miR-197	CLIP-seq
MIRT2288105	hsa-miR-3126-3p	CLIP-seq
MIRT2288106	hsa-miR-3135b	CLIP-seq
MIRT2288107	hsa-miR-3192	CLIP-seq
MIRT2288108	hsa-miR-3199	CLIP-seq
MIRT1207992	hsa-miR-3663-5p	CLIP-seq
MIRT2288109	hsa-miR-4314	CLIP-seq
MIRT1207995	hsa-miR-4418	CLIP-seq
MIRT1207997	hsa-miR-4438	CLIP-seq
MIRT1207998	hsa-miR-4454	CLIP-seq
MIRT2288110	hsa-miR-4646-5p	CLIP-seq
MIRT1208001	hsa-miR-4707-3p	CLIP-seq
MIRT1208005	hsa-miR-4755-3p	CLIP-seq
MIRT2288111	hsa-miR-4763-5p	CLIP-seq
MIRT1208008	hsa-miR-509-3-5p	CLIP-seq
MIRT1208009	hsa-miR-5095	CLIP-seq
MIRT1208010	hsa-miR-509-5p	CLIP-seq
MIRT2288112	hsa-miR-550a	CLIP-seq
MIRT2288113	hsa-miR-552	CLIP-seq
MIRT2288114	hsa-miR-764	CLIP-seq
MIRT1207986	hsa-miR-1184	CLIP-seq
MIRT1207987	hsa-miR-1281	CLIP-seq
MIRT1207995	hsa-miR-4418	CLIP-seq
MIRT1208000	hsa-miR-4532	CLIP-seq
MIRT1208008	hsa-miR-509-3-5p	CLIP-seq
MIRT1208010	hsa-miR-509-5p	CLIP-seq
MIRT1207986	hsa-miR-1184	CLIP-seq
MIRT1207987	hsa-miR-1281	CLIP-seq
MIRT1207995	hsa-miR-4418	CLIP-seq
MIRT1208000	hsa-miR-4532	CLIP-seq
MIRT1208008	hsa-miR-509-3-5p	CLIP-seq
MIRT1208010	hsa-miR-509-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	23827681
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0035523	Process	Protein K29-linked deubiquitination	IDA	23827681
GO:0035871	Process	Protein K11-linked deubiquitination	IDA	23827681
GO:1990167	Process	Protein K27-linked deubiquitination	IDA	23827681
GO:1990168	Process	Protein K33-linked deubiquitination	IDA	23827681

Other IDs

• MIM: 300714
• HGNC: 32312
• e!Ensembl: ENSG00000189401

Protein

• UniProt ID: Q7L8S5
• Protein name: OTU domain-containing protein 6A (EC 3.4.19.12) (DUBA-2)
• Protein function: Deubiquitinating enzyme that hydrolyzes 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains. Also able to hydrolyze 'Lys-11'-linked ubiquitin chains.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02338	OTU	147 → 269	OTU-like cysteine protease	Family

• Sequence:

  MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHR
  QELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEH
  LAGFKREEEEKLAAILGARGLEMKAIPADGHCMYRAIQDQLVFSVSVEMLRCRTASYMKK
  HVDEFLPFFSNPETSDSFGYDDFMIYCDNIVRTTAWGGQLELRALSHVLKTPIEVIQADS
  PTLIIGEEYVKKPIILVYLRYAYSLGEHYNSVTPLEAGAAGGVLPRLL

• Sequence length: 288

Related Genes

No strongly related genes found yet for OTUD6A.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OTUD6A.