OTP (orthopedia homeobox)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23440
• Gene name: Orthopedia homeobox
• Gene symbol: OTP
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q14.1
• Summary: This gene encodes a member of the homeodomain (HD) family. HD family proteins are helix-turn-helix transcription factors that play key roles in the specification of cell fates. This protein may function during brain development. [provided by RefSeq, Jul 2

miRNA Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047869	hsa-miR-30c-5p	CLASH	23622248
MIRT2287951	hsa-miR-1276	CLIP-seq
MIRT2287952	hsa-miR-1908	CLIP-seq
MIRT2287953	hsa-miR-298	CLIP-seq
MIRT2287954	hsa-miR-3160-3p	CLIP-seq
MIRT2287955	hsa-miR-3662	CLIP-seq
MIRT2287956	hsa-miR-4533	CLIP-seq
MIRT2287957	hsa-miR-4747-5p	CLIP-seq
MIRT2287958	hsa-miR-634	CLIP-seq
MIRT2287959	hsa-miR-663	CLIP-seq

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	29107289
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	29107289
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	29107289
GO:0001650	Component	Fibrillar center	IDA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0021879	Process	Forebrain neuron differentiation	IEA
GO:0021979	Process	Hypothalamus cell differentiation	IEA
GO:0021985	Process	Neurohypophysis development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0061101	Process	Neuroendocrine cell differentiation	IEA
GO:0071542	Process	Dopaminergic neuron differentiation	IEA

Other IDs

• MIM: 604529
• HGNC: 8518
• e!Ensembl: ENSG00000171540

Protein

• UniProt ID: Q5XKR4
• Protein name: Homeobox protein orthopedia
• Protein function: Probably involved in the differentiation of hypothalamic neuroendocrine cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	105 → 161	Homeodomain	Domain
  PF03826	OAR	302 → 320	OAR motif	Motif

• Sequence:

  MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPG
  EDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
  RSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPG
  LPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCS
  LAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSS
  DVWRGTSIASLRRKALEHTVSMSFT

• Sequence length: 325

Related Genes

No strongly related genes found yet for OTP.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OTP.