OTOP1 (otopetrin 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 133060
• Gene name: Otopetrin 1
• Gene symbol: OTOP1
• Synonyms (NCBI Gene): -
• Chromosome: 4
• Chromosome location: 4p16.3
• Summary: This gene encodes a transmembrane protein which belongs to the otopetrin domain protein family and is required for the formation of otoconia and otoliths, calcium carbonate biominerals within the inner ear of mammals that are required for the detection of

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	36266567
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005902	Component	Microvillus	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0009590	Process	Detection of gravity	IEA
GO:0015252	Function	Proton channel activity	IBA
GO:0015252	Function	Proton channel activity	IDA	29371428, 36266567
GO:0015252	Function	Proton channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0031214	Process	Biomineral tissue development	IEA
GO:0032475	Process	Otolith formation	IBA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IBA
GO:0042802	Function	Identical protein binding	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045299	Process	Otolith mineralization	IBA
GO:0060336	Process	Negative regulation of type II interferon-mediated signaling pathway	IEA
GO:0060336	Process	Negative regulation of type II interferon-mediated signaling pathway	ISS
GO:1902600	Process	Proton transmembrane transport	IBA
GO:1902600	Process	Proton transmembrane transport	IDA	29371428, 36266567
GO:1902600	Process	Proton transmembrane transport	IEA

Other IDs

• MIM: 607806
• HGNC: 19656
• e!Ensembl: ENSG00000163982

Protein

• UniProt ID: Q7RTM1
• Protein name: Proton channel OTOP1 (Otopetrin-1) (hOtop1)
• Protein function: Proton-selective ion channel (PubMed:29371428, PubMed:36266567). Biphasically modulated by acid and alkali, mediating proton influx and efflux in response to extracellular acid and base stimulation, respectively. Sour taste receptor, which carri
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03189	Otopetrin	240 → 465	Otopetrin	Family
  PF03189	Otopetrin	132 → 237	Otopetrin	Family
  PF03189	Otopetrin	528 → 599	Otopetrin	Family

• Sequence:

  MLEGLGSPASPRAAASASVAGSSGPAACSPPSSSAPRSPESPAPRRGGVRASVPQKLAEM
  LSSQYGLIVFVAGLLLLLAWAVHAAGVSKSDLLCFLTALMLLQLLWMLWYVGRSSAHRRL
  FRLKDTHAGAGWLRGSITLFAVITVILGCLKIGYFIGFSECLSATEGVFPVTHSVHTLLQ
  VYFLWGHAKDIIQSFKTLERFGVIHSVFTNLLLWANGVLNESKHQLNEHKERLITLGFGN
  ITTVLDDHTPQCNCTPPTLCTAISHGIYYLYPFNIEYQILASTMLYVLWKNIGRKVDSHQ
  HQKMQFKSDGVMVGAVLGLTVLAATIAVVVVYLIHIGRSKTKSESALIMFYLYAITLLML
  MGAAGLAGIRIYRIDEKSLDESKNPARKLDSDLLVGTASGSWLISWGSILAILCAEGHPR
  YTWYNLPYSILAIVEKYIQNLFIFESIHREPEKLSEDIQTLRVVTVCNGNTMPLASSCPK
  SGGVARDVAPQGKDMPPAANGNVCMRESHDKEEEKQEESSWGGSPSPVRLPRFLQGNAKR
  KVLRNIAAFLFLCNISLWIPPAFGCRPEYDNGLEEIVFGFEPWIIVVNLAMPFSIFYRMH
  AAASLFEVYCKI

• Sequence length: 612

Related Genes

No strongly related genes found yet for OTOP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OTOP1.