Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4999
Gene name	Origin recognition complex subunit 2
Gene symbol	ORC2
Synonyms (NCBI Gene)	ORC2L
Chromosome	2
Chromosome location	2q33.1
Summary	The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves

165 Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023388	hsa-miR-122-5p	Microarray	17612493
MIRT048408	hsa-miR-100-5p	CLASH	23622248
MIRT041002	hsa-miR-505-3p	CLASH	23622248
MIRT037366	hsa-miR-877-5p	CLASH	23622248
MIRT1205273	hsa-miR-1206	CLIP-seq
MIRT1205274	hsa-miR-1208	CLIP-seq
MIRT1205275	hsa-miR-1236	CLIP-seq
MIRT1205276	hsa-miR-1245b-3p	CLIP-seq
MIRT1205277	hsa-miR-1287	CLIP-seq
MIRT1205278	hsa-miR-1298	CLIP-seq
MIRT1205279	hsa-miR-1305	CLIP-seq
MIRT1205280	hsa-miR-1306	CLIP-seq
MIRT1205281	hsa-miR-136	CLIP-seq
MIRT1205282	hsa-miR-30a	CLIP-seq
MIRT1205283	hsa-miR-30b	CLIP-seq
MIRT1205284	hsa-miR-30c	CLIP-seq
MIRT1205285	hsa-miR-30d	CLIP-seq
MIRT1205286	hsa-miR-30e	CLIP-seq
MIRT1205287	hsa-miR-3125	CLIP-seq
MIRT1205288	hsa-miR-3135b	CLIP-seq
MIRT1205289	hsa-miR-3148	CLIP-seq
MIRT1205290	hsa-miR-3163	CLIP-seq
MIRT1205291	hsa-miR-3194-5p	CLIP-seq
MIRT1205292	hsa-miR-320a	CLIP-seq
MIRT1205293	hsa-miR-320b	CLIP-seq
MIRT1205294	hsa-miR-320c	CLIP-seq
MIRT1205295	hsa-miR-320d	CLIP-seq
MIRT1205296	hsa-miR-320e	CLIP-seq
MIRT1205297	hsa-miR-338-3p	CLIP-seq
MIRT1205298	hsa-miR-3613-3p	CLIP-seq
MIRT1205299	hsa-miR-3622a-3p	CLIP-seq
MIRT1205300	hsa-miR-3622b-3p	CLIP-seq
MIRT1205301	hsa-miR-3660	CLIP-seq
MIRT1205302	hsa-miR-3664-5p	CLIP-seq
MIRT1205303	hsa-miR-3680	CLIP-seq
MIRT1205304	hsa-miR-382	CLIP-seq
MIRT1205305	hsa-miR-3916	CLIP-seq
MIRT1205306	hsa-miR-4256	CLIP-seq
MIRT1205307	hsa-miR-4427	CLIP-seq
MIRT1205308	hsa-miR-4429	CLIP-seq
MIRT1205309	hsa-miR-4446-5p	CLIP-seq
MIRT1205310	hsa-miR-4495	CLIP-seq
MIRT1205311	hsa-miR-4517	CLIP-seq
MIRT1205312	hsa-miR-451b	CLIP-seq
MIRT1205313	hsa-miR-4526	CLIP-seq
MIRT1205314	hsa-miR-4530	CLIP-seq
MIRT1205315	hsa-miR-4698	CLIP-seq
MIRT1205316	hsa-miR-4714-5p	CLIP-seq
MIRT1205317	hsa-miR-4733-5p	CLIP-seq
MIRT1205318	hsa-miR-4760-3p	CLIP-seq
MIRT1205319	hsa-miR-4775	CLIP-seq
MIRT1205320	hsa-miR-4798-3p	CLIP-seq
MIRT1205321	hsa-miR-642b	CLIP-seq
MIRT1205322	hsa-miR-659	CLIP-seq
MIRT1205323	hsa-miR-875-3p	CLIP-seq
MIRT1205324	hsa-miR-877	CLIP-seq
MIRT1205325	hsa-miR-885-5p	CLIP-seq
MIRT1205326	hsa-miR-889	CLIP-seq
MIRT2059200	hsa-miR-103b	CLIP-seq
MIRT1205273	hsa-miR-1206	CLIP-seq
MIRT2059201	hsa-miR-1207-3p	CLIP-seq
MIRT1205274	hsa-miR-1208	CLIP-seq
MIRT2059202	hsa-miR-122	CLIP-seq
MIRT2059203	hsa-miR-125a-5p	CLIP-seq
MIRT2059204	hsa-miR-125b	CLIP-seq
MIRT1205278	hsa-miR-1298	CLIP-seq
MIRT1205279	hsa-miR-1305	CLIP-seq
MIRT2059205	hsa-miR-145	CLIP-seq
MIRT2059206	hsa-miR-203	CLIP-seq
MIRT2059207	hsa-miR-2114	CLIP-seq
MIRT1205287	hsa-miR-3125	CLIP-seq
MIRT1205298	hsa-miR-3613-3p	CLIP-seq
MIRT1205299	hsa-miR-3622a-3p	CLIP-seq
MIRT1205300	hsa-miR-3622b-3p	CLIP-seq
MIRT2059208	hsa-miR-3659	CLIP-seq
MIRT2059209	hsa-miR-3663-3p	CLIP-seq
MIRT2059210	hsa-miR-371b-5p	CLIP-seq
MIRT2059211	hsa-miR-376c	CLIP-seq
MIRT1205305	hsa-miR-3916	CLIP-seq
MIRT2059212	hsa-miR-3925-3p	CLIP-seq
MIRT2059213	hsa-miR-4319	CLIP-seq
MIRT2059214	hsa-miR-4731-5p	CLIP-seq
MIRT2059215	hsa-miR-4732-3p	CLIP-seq
MIRT1205318	hsa-miR-4760-3p	CLIP-seq
MIRT2059216	hsa-miR-511	CLIP-seq
MIRT2059217	hsa-miR-520a-5p	CLIP-seq
MIRT2059218	hsa-miR-525-5p	CLIP-seq
MIRT2059219	hsa-miR-548aa	CLIP-seq
MIRT2059220	hsa-miR-548p	CLIP-seq
MIRT2059221	hsa-miR-570	CLIP-seq
MIRT1205321	hsa-miR-642b	CLIP-seq
MIRT2059222	hsa-miR-670	CLIP-seq
MIRT2059223	hsa-miR-766	CLIP-seq
MIRT1205324	hsa-miR-877	CLIP-seq
MIRT2059224	hsa-miR-885-3p	CLIP-seq
MIRT2059201	hsa-miR-1207-3p	CLIP-seq
MIRT2059202	hsa-miR-122	CLIP-seq
MIRT2287306	hsa-miR-124	CLIP-seq
MIRT1205276	hsa-miR-1245b-3p	CLIP-seq
MIRT2287307	hsa-miR-1299	CLIP-seq
MIRT1205279	hsa-miR-1305	CLIP-seq
MIRT1205282	hsa-miR-30a	CLIP-seq
MIRT1205283	hsa-miR-30b	CLIP-seq
MIRT1205284	hsa-miR-30c	CLIP-seq
MIRT1205285	hsa-miR-30d	CLIP-seq
MIRT1205286	hsa-miR-30e	CLIP-seq
MIRT1205287	hsa-miR-3125	CLIP-seq
MIRT1205298	hsa-miR-3613-3p	CLIP-seq
MIRT2059208	hsa-miR-3659	CLIP-seq
MIRT2287308	hsa-miR-3692	CLIP-seq
MIRT2059210	hsa-miR-371b-5p	CLIP-seq
MIRT1205305	hsa-miR-3916	CLIP-seq
MIRT2059212	hsa-miR-3925-3p	CLIP-seq
MIRT1205310	hsa-miR-4495	CLIP-seq
MIRT2059214	hsa-miR-4731-5p	CLIP-seq
MIRT1205319	hsa-miR-4775	CLIP-seq
MIRT2287309	hsa-miR-488	CLIP-seq
MIRT2287310	hsa-miR-495	CLIP-seq
MIRT2287311	hsa-miR-506	CLIP-seq
MIRT2059217	hsa-miR-520a-5p	CLIP-seq
MIRT2059218	hsa-miR-525-5p	CLIP-seq
MIRT2287312	hsa-miR-542-5p	CLIP-seq
MIRT2287313	hsa-miR-548an	CLIP-seq
MIRT2059220	hsa-miR-548p	CLIP-seq
MIRT2287314	hsa-miR-603	CLIP-seq
MIRT2059223	hsa-miR-766	CLIP-seq
MIRT1205323	hsa-miR-875-3p	CLIP-seq
MIRT1205324	hsa-miR-877	CLIP-seq
MIRT2059224	hsa-miR-885-3p	CLIP-seq
MIRT2059201	hsa-miR-1207-3p	CLIP-seq
MIRT2059214	hsa-miR-4731-5p	CLIP-seq
MIRT2059224	hsa-miR-885-3p	CLIP-seq
MIRT2287307	hsa-miR-1299	CLIP-seq
MIRT1205302	hsa-miR-3664-5p	CLIP-seq
MIRT2287308	hsa-miR-3692	CLIP-seq
MIRT1205309	hsa-miR-4446-5p	CLIP-seq
MIRT2585507	hsa-miR-4641	CLIP-seq
MIRT1205316	hsa-miR-4714-5p	CLIP-seq
MIRT2287310	hsa-miR-495	CLIP-seq
MIRT2059216	hsa-miR-511	CLIP-seq
MIRT2585508	hsa-miR-518a-5p	CLIP-seq
MIRT2585509	hsa-miR-527	CLIP-seq
MIRT2059219	hsa-miR-548aa	CLIP-seq
MIRT2059220	hsa-miR-548p	CLIP-seq
MIRT2287314	hsa-miR-603	CLIP-seq
MIRT1205321	hsa-miR-642b	CLIP-seq
MIRT1205323	hsa-miR-875-3p	CLIP-seq
MIRT2059202	hsa-miR-122	CLIP-seq
MIRT2287307	hsa-miR-1299	CLIP-seq
MIRT2059208	hsa-miR-3659	CLIP-seq
MIRT1205302	hsa-miR-3664-5p	CLIP-seq
MIRT2287308	hsa-miR-3692	CLIP-seq
MIRT1205309	hsa-miR-4446-5p	CLIP-seq
MIRT2585507	hsa-miR-4641	CLIP-seq
MIRT1205316	hsa-miR-4714-5p	CLIP-seq
MIRT2287310	hsa-miR-495	CLIP-seq
MIRT2059216	hsa-miR-511	CLIP-seq
MIRT2585508	hsa-miR-518a-5p	CLIP-seq
MIRT2585509	hsa-miR-527	CLIP-seq
MIRT2287312	hsa-miR-542-5p	CLIP-seq
MIRT2059219	hsa-miR-548aa	CLIP-seq
MIRT2059220	hsa-miR-548p	CLIP-seq
MIRT2287314	hsa-miR-603	CLIP-seq
MIRT1205321	hsa-miR-642b	CLIP-seq
MIRT1205323	hsa-miR-875-3p	CLIP-seq

28 Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8808289
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000781	Component	Chromosome, telomeric region	IDA	24270157
GO:0000785	Component	Chromatin	IEA
GO:0000792	Component	Heterochromatin	IDA	15215892
GO:0000792	Component	Heterochromatin	IEA
GO:0000808	Component	Origin recognition complex	IDA	17716973
GO:0000808	Component	Origin recognition complex	IEA
GO:0000939	Component	Inner kinetochore	IEA
GO:0003688	Function	DNA replication origin binding	IBA
GO:0003688	Function	DNA replication origin binding	IEA
GO:0003688	Function	DNA replication origin binding	TAS	8808289
GO:0005515	Function	Protein binding	IPI	11095689, 11931757, 12364596, 15232106, 16549788, 16799465, 17716973, 18946490, 20467437, 20932478, 21383955, 22398447, 25609649, 26496610, 31467278, 32296183
GO:0005634	Component	Nucleus	IDA	21383955
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	32808929
GO:0005634	Component	Nucleus	TAS	8808289
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005664	Component	Nuclear origin of replication recognition complex	IBA
GO:0005664	Component	Nuclear origin of replication recognition complex	IDA	20932478, 21029866
GO:0005664	Component	Nuclear origin of replication recognition complex	IEA
GO:0005664	Component	Nuclear origin of replication recognition complex	IPI	16549788
GO:0005813	Component	Centrosome	IDA	15215892
GO:0006260	Process	DNA replication	IEA
GO:0006270	Process	DNA replication initiation	IDA	16549788
GO:0006270	Process	DNA replication initiation	TAS	8808289
GO:0016020	Component	Membrane	HDA	19946888

MIM	HGNC	e!Ensembl
601182	8488	ENSG00000115942

Q13416

Protein name

Origin recognition complex subunit 2

Protein function

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-re

PDB

5C8H , 5UJ8 , 5UJM , 7CTE , 7CTF , 7CTG , 7JPO , 7JPP , 7JPQ , 7JPR , 7JPS , 8RWV , 8S0C , 8S0D , 8S0E , 8S0F

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04084	ORC2	255 → 565	Origin recognition complex subunit 2	Family

Sequence

MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEED
DQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKS
VSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSE
SEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLV
EEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHK
WMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVL
DHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHV
LRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFR
DHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA

Sequence length

577

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cell cycle	Activation of ATR in response to replication stress
	Assembly of the ORC complex at the origin of replication
	CDC6 association with the ORC:origin complex
	CDT1 association with the CDC6:ORC:origin complex
	Assembly of the pre-replicative complex
	Orc1 removal from chromatin
	Activation of the pre-replicative complex

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ORC6	[]	8	["Cell cycle","Activation of ATR in response to replication stress","Orc1 removal from chromatin","Activation of the pre-replicative complex","CDT1 association with the CDC6:ORC:origin complex","CDC6 association with the ORC:origin complex","Assembly of the ORC complex at the origin of replication","Assembly of the pre-replicative complex"]	[]
ORC3	[]	8	["Cell cycle","Activation of ATR in response to replication stress","Orc1 removal from chromatin","Activation of the pre-replicative complex","CDT1 association with the CDC6:ORC:origin complex","CDC6 association with the ORC:origin complex","Assembly of the ORC complex at the origin of replication","Assembly of the pre-replicative complex"]	[]
ORC4	[]	8	["Cell cycle","Activation of ATR in response to replication stress","Orc1 removal from chromatin","Activation of the pre-replicative complex","CDT1 association with the CDC6:ORC:origin complex","CDC6 association with the ORC:origin complex","Assembly of the ORC complex at the origin of replication","Assembly of the pre-replicative complex"]	[]
ORC5	[]	8	["Cell cycle","Activation of ATR in response to replication stress","Orc1 removal from chromatin","Activation of the pre-replicative complex","CDT1 association with the CDC6:ORC:origin complex","CDC6 association with the ORC:origin complex","Assembly of the ORC complex at the origin of replication","Assembly of the pre-replicative complex"]	[]
ORC1	[]	8	["Cell cycle","Activation of ATR in response to replication stress","Orc1 removal from chromatin","Activation of the pre-replicative complex","CDT1 association with the CDC6:ORC:origin complex","CDC6 association with the ORC:origin complex","Assembly of the ORC complex at the origin of replication","Assembly of the pre-replicative complex"]	[]

ORC2 (origin recognition complex subunit 2)

Bookmark This Gene