Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	219957
Gene name	Olfactory receptor family 9 subfamily Q member 2
Gene symbol	OR9Q2
Synonyms (NCBI Gene)	OR9Q2P
Chromosome	11
Chromosome location	11q12.1
Summary	Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005549	Function	Odorant binding	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IBA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8NGE9

Protein name

Olfactory receptor 9Q2

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13853	7tm_4	31 → 308	Olfactory receptor	Family

Sequence

MAERNYTVVTEFFLTAFTEHLQWRVPLFLIFLSFYLATMLGNTGMILLIRGDRRLHTPMY
FFLSHLSLVDICYSSAIIPQMLAVLWEHGTTISQARCAAQFFLFTFFASIDCYLLAIMAY
DRYTAVCQPLLYVTIITEKARWGLVTGAYVAGFFSAFVRTVTAFTLSFCGNNEINFIFCD
LPPLLKLSCGDSYTQEVVIIVFALFVMPACILVILVSYLFIIVAILQIHSAGGRAKTFST
CASHLTAVALFFGTLIFMYLRDNTGQSSEGDRVVSVLYTVVTPMLNPLIYSLRNKEVKEA
TRKALSKSKPARRP

Sequence length

314

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Olfactory transduction	Olfactory Signaling Pathway

Related Genes Genes most often co-reported with OR9Q2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OR9Q2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OR9Q2 (see Related Genes above), that are NOT already directly curated for OR9Q2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OR9Q2.

OR9Q2 (olfactory receptor family 9 subfamily Q member 2)

Bookmark This Gene