Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	387815
Gene name	Olfactory receptor family 8 subfamily G member 3 (gene/pseudogene)
Gene symbol	OR8G3
Synonyms (NCBI Gene)	OR8G3P
Chromosome	11
Chromosome location	11q24.2

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	NAS	9119360
GO:0005549	Function	Odorant binding	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IBA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	NAS	9119360
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9119360
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

P0DMU2

Protein name

Olfactory receptor 8G3 (Olfactory receptor OR11-297)

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13853	7tm_4	31 → 308	Olfactory receptor	Family

Sequence

MDPGNHSSVTESILAGLSEQPELQLRLFLLFLGICVVTVVGNLGMITLIGLSSHLHTPMY
YFLSSLSFIDFCHSTVITPKMLVNFATEKNIISYPECMAQLYLFSIFAIAECHMLAAMAY
DCYVAICSPLLYNVIMSYHHCFWLTVGVYILGILGSTIHTSFMLRLFLCKTNVINHYFCD
LFPLLGLSCSSTYINELLVLVLSAFNILMPALTILASYIFIIASILRIHSTEGRSKAFST
CSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTTIVPMLNPLIYSLRNKDVKLA
VKKILHQTAC

Sequence length

310

Interactions

View interactions

KEGG Pathway
Olfactory transduction

Related Genes Genes most often co-reported with OR8G3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OR8G3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OR8G3 (see Related Genes above), that are NOT already directly curated for OR8G3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OR8G3.

OR8G3 (olfactory receptor family 8 subfamily G member 3 (gene/pseudogene))

Bookmark This Gene