OR8G2P (olfactory receptor family 8 subfamily G member 2 pseudogene)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26492
• Gene name: Olfactory receptor family 8 subfamily G member 2 pseudogene
• Gene symbol: OR8G2P
• Synonyms (NCBI Gene): HSTPCR120, OR8G2, OR8G4, ORL206, ORL486, TPCR120
• Chromosome: 11
• Chromosome location: 11q24.2
• Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005549	Function	Odorant binding	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IBA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6IF36
• Protein name: Olfactory receptor 8G2 (Olfactory receptor 8G4) (Olfactory receptor OR11-292) (Olfactory receptor TPCR120)
• Protein function: Odorant receptor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13853	7tm_4	44 → 303	Olfactory receptor	Family

• Sequence:

  MVFLSSVETDQRKMSAGNHSSVTEFILAGLSEQPELQLRLFLLFLGIYVVTVVGNLSMIT
  LIGLSSHLHTPMYYFLSGLSFIDLCHSTIITPKMLVNFVTEKNIISYPECMTQLYFFLIF
  AIAECHMLAVTAYDRYVAICSPLLYNVIMSYHHCFWLTVGVYVLGILGSTIHTGFMLRLF
  LCKTNVINHYFCDLFPLLGLSCSSTYINELLVLVLSAFNILTPALTILASYIFIIASILR
  IRSTEGRSKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQRKVSSVFYTTIVPMLNP
  QSIA

• Sequence length: 304

Pathways

Reactome Pathway:

Olfactory Signaling Pathway

Related Genes

No strongly related genes found yet for OR8G2P.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OR8G2P.