OR4F17 (olfactory receptor family 4 subfamily F member 17)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 81099
Gene name Olfactory receptor family 4 subfamily F member 17
Gene symbol OR4F17
Synonyms (NCBI Gene)
OR4F11POR4F18OR4F19OR4F5
Chromosome 19
Chromosome location 19p13.3
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004984 Function Olfactory receptor activity IBA
GO:0004984 Function Olfactory receptor activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NGA8
Protein name Olfactory receptor 4F17 (Olfactory receptor 4F11) (Olfactory receptor 4F18) (Olfactory receptor 4F19)
Protein function Odorant receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13853 7tm_4 23 → 296 Olfactory receptor Family
Sequence 
MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH
SSVKF
Sequence length 305
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Olfactory transduction Olfactory Signaling Pathway

No strongly related genes found yet for OR4F17.

No additional diseases found yet through genes similar to OR4F17.