Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	81406
Gene name	Olfactory receptor family 2 subfamily W member 6 pseudogene
Gene symbol	OR2W6P
Synonyms (NCBI Gene)	OR2W7P
Chromosome	6
Chromosome location	6p22.1
Summary	Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8NHA6

Protein name

Putative olfactory receptor 2W6 (Olfactory receptor OR6-3) (Putative olfactory receptor 2W7)

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13853	7tm_4	37 → 313	Olfactory receptor	Family

Sequence

MGFYHVGQAAFELLTSSFILVGFSDRPHLELIVFVVVLIFYLLTLLGNMTIVLLSALDSR
LHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGVECVL
LAVMAYDRYAAVCKPLHYTIIMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRV
DHFLCEMPALIGMACVDTMMLEALAFALAIFIILAPLILILISYGYVGGTVLRIKSAAGR
KKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFYTIVTPSVNPLIYTLRN
KDVKEAMKKVLGKGSAEI

Sequence length

318

Interactions

View interactions

Related Genes Genes most often co-reported with OR2W6P across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OR2W6P.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OR2W6P (see Related Genes above), that are NOT already directly curated for OR2W6P itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OR2W6P.

OR2W6P (olfactory receptor family 2 subfamily W member 6 pseudogene)

Bookmark This Gene