Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	441932
Gene name	Olfactory receptor family 2 subfamily W member 5 pseudogene
Gene symbol	OR2W5P
Synonyms (NCBI Gene)	OR2W5OST722
Chromosome	1
Chromosome location	1q44
Summary	Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

A6NFC9

Protein name

Putative olfactory receptor 2W5 pseudogene

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	41 → 194	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MGKDNASYLQAFILVGSSDRPGLEKILFAVILIFCILTLVGNTAIILLLVMDVRLHTPMY
FFLGNLSFLDLCFTASIAPQLLWNLGGPEKTITYHGCVAQLYIYMMLGSTECVLLVVMSH
DRYVAVCRSLHYMAVMRPHLCLQLVTVAWCCGFLNSFIMCPQTMQLSRCGRRRVDHFLCE
MPALIAMSCEETMLVEAIHLCPGGGSPPGAALPHPHLLWRDCSRGAEDEVSSRAKESLPH
LLFSPHSGLSLLRNHHLRVPEAGQQLLPRSGEVPDSLLHHRHSQHQPPHLHFEEQGCEGD
HEETSGVGERGWGASTRGTL

Sequence length

320

Interactions

View interactions

Reactome Pathway
Olfactory Signaling Pathway

Related Genes Genes most often co-reported with OR2W5P across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OR2W5P.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OR2W5P (see Related Genes above), that are NOT already directly curated for OR2W5P itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OR2W5P.

OR2W5P (olfactory receptor family 2 subfamily W member 5 pseudogene)

Bookmark This Gene