OR2AT4 (olfactory receptor family 2 subfamily AT member 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 341152
• Gene name: Olfactory receptor family 2 subfamily AT member 4
• Gene symbol: OR2AT4
• Synonyms (NCBI Gene): OR11-265
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IDA	24999593, 30228264
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24999593
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	24999593

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A6NND4
• Protein name: Olfactory receptor 2AT4 (Olfactory receptor OR11-265)
• Protein function: Olfactory receptor (PubMed:24999593, PubMed:30228264). Activated by the synthetic sandalwood odorant sandalore (PubMed:24999593, PubMed:30228264). Endogenous ligand is unknown (Probable). The activity of this receptor is probably mediated by G p
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13853	7tm_4	36 → 313	Olfactory receptor	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in the keratinocytes of the epidermis (at protein level) (PubMed:24999593). Detected in hair follicles in proximal outer root sheath and hair matrix keratinocytes (at protein level) (PubMed:30228264). {ECO:0000269|PubMed:24999
• Sequence:

  MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSL
  HKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFIL
  VVMAYDRYVAICHPLHYPVLMNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIY
  HCFCDHLAVVQASCSDTTPQTLMGFCIAMVVSFLPLLLVLLSYVHILASVLRISSLEGRA
  KAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPILNPLIYTLRNR
  DVKAAITKIMSQDPGCDRSI

• Sequence length: 320

Pathways

KEGG Pathway:

Olfactory transduction

Reactome Pathway:

Olfactory Signaling Pathway

Related Genes

No strongly related genes found yet for OR2AT4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OR2AT4.