OR1Q1 (olfactory receptor family 1 subfamily Q member 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 158131
• Gene name: Olfactory receptor family 1 subfamily Q member 1
• Gene symbol: OR1Q1
• Synonyms (NCBI Gene): HSTPCR106, OR1Q2, OR1Q3, OR9-25, OR9-A, OST226, OST226OR9-A, TPCR106
• Chromosome: 9
• Chromosome location: 9q33.2
• Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	NAS	9119360
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	NAS	9119360
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9119360
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q15612
• Protein name: Olfactory receptor 1Q1 (OST226) (Olfactory receptor 1Q2) (Olfactory receptor 1Q3) (Olfactory receptor 9-A) (OR9-A) (Olfactory receptor OR9-25) (Olfactory receptor TPCR106)
• Protein function: Odorant receptor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13853	7tm_4	31 → 308	Olfactory receptor	Family

• Sequence:

  MDNSNWTSVSHFVLLGISTHPEEQIPLFLVFSLMYAINISGNLAIITLILSAPRLHIPMY
  IFLSNLALTDICFTSTTVPKMLQIIFSPTKVISYTGCLAQTYFFICFAVMENFILAVMAY
  DRYIAICHPFHYTMILTRMLCVKMVVMCHALSHLHAMLHTFLIGQLIFCADNRIPHFFCD
  LYALMKISCTSTYLNTLMIHTEGAVVISGALAFITASYACIILVVLRIPSAKGRWKTFST
  CGSHLTVVAIFYGTLSWVYFRPLSSYSVTKGRIITVVYTVVTPMLNPFIYSLRNGDVKGG
  FMKWMSRMQTFFFR

• Sequence length: 314

Pathways

KEGG Pathway:

Olfactory transduction

Reactome Pathway:

Olfactory Signaling Pathway

Related Genes

No strongly related genes found yet for OR1Q1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OR1Q1.