OR1F1 (olfactory receptor family 1 subfamily F member 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4992
Gene name Olfactory receptor family 1 subfamily F member 1
Gene symbol OR1F1
Synonyms (NCBI Gene)
OLFMFOR16-36OR16-37OR16-88OR16-89OR16-90OR1F10OR1F13POR1F4OR1F5OR1F6OR1F7OR1F8OR1F9OR3-145ORL1023
Chromosome 16
Chromosome location 16p13.3
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004984 Function Olfactory receptor activity IBA
GO:0004984 Function Olfactory receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
603232 8194 ENSG00000168124
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43749
Protein name Olfactory receptor 1F1 (Olfactory receptor 16-35) (OR16-35) (Olfactory receptor 1F10) (Olfactory receptor 1F4) (Olfactory receptor 1F5) (Olfactory receptor 1F6) (Olfactory receptor 1F7) (Olfactory receptor 1F8) (Olfactory receptor 1F9) (Olfactory receptor
Protein function Odorant receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13853 7tm_4 31 → 307 Olfactory receptor Family
Sequence 
MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMY
FFLSNLSFVDICFSFTTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAY
DHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCD
VTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFST
CGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGA
LKKVVGRVVFSV
Sequence length 312
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Olfactory transduction Olfactory Signaling Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Hirschsprung disease, susceptibility to, 1 Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 21694446 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for OR1F1.

No additional diseases found yet through genes similar to OR1F1.