OR1E3 (olfactory receptor family 1 subfamily E member 3 (gene/pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 8389
Gene name Olfactory receptor family 1 subfamily E member 3 (gene/pseudogene)
Gene symbol OR1E3
Synonyms (NCBI Gene)
OR17-210OR1E3P
Chromosome 17
Chromosome location 17p13.3
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004984 Function Olfactory receptor activity IBA
GO:0004984 Function Olfactory receptor activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WZA6
Protein name Olfactory receptor 1E3 (Olfactory receptor 17-210) (OR17-210) (Olfactory receptor OR17-7)
Protein function Odorant receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13853 7tm_4 31 → 308 Olfactory receptor Family
Sequence 
MMKKNQTMISEFLLLGLPIQPEQQNLFYALFLAVYLTTLLGNLLVIVLIRLDSHLHMPMY
LCLSNLSFSDLCFSSVTMPKLLQNMQSQNPSIPFADCLAQMYFHLFYGVLESFLLVVMAY
HCYVAICFPLHYTTIMSPKCCLGLLTLSWLLTTAHATLHTLLMARLSFCAENVIPHFFCD
TSTLLKLACSNTQVNGWVMFFMGGLILVIPFLLLIMSCARIVSTILRVPSTGGIQKAFST
CGPHLSVVSLFYGTIIGLYLCPLTNHNTVKDTVMAVMYTGVTHMLNPFIYSLRNRDMRGN
PGQSLQHKENFFVFKIVIVGILPLLNLVGVVKLIMKYHSKSVA
Sequence length 343
Interactions View interactions

No strongly related genes found yet for OR1E3.

No additional diseases found yet through genes similar to OR1E3.