Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	26530
Gene name	Olfactory receptor family 12 subfamily D member 1 (gene/pseudogene)
Gene symbol	OR12D1
Synonyms (NCBI Gene)	OR12D1Phs6M1-19
Chromosome	6
Chromosome location	6p22.1
Summary	Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

11 Show/Hide all (11)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005549	Function	Odorant binding	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IBA

MIM	HGNC	e!Ensembl
HGNC	8177	N/A

P0DN82

Protein name

Olfactory receptor 12D1

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13853	7tm_4	29 → 300	Olfactory receptor	Family

Sequence

MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVAGNGAILMIVISDPRLHSPMYFF
LGNLSCLDICYSSVTLPKMLQNFLSAHKAISFLGCISQLHFFHFLGSTEAMLLAVMAFDR
FVAICKPLRYTVIMNPQLCTQMAITIWMIGFFHALLHSLMTSRLNFCGSNRIYHFFCDVK
PLLKLSNQWLLSTVTGTIAMGPFFLTLLSYFYIITHLFFKTHSFSMLRKALSTCASHFMV
VILLYAPVLFTYIHHASGTSMDQDRITAIMYTVVTPVLNPLIYTLRNKEVKGAFNRAMKR
WLWPKEILK

Sequence length

309

Interactions

View interactions

KEGG Pathway
Olfactory transduction

Related Genes Genes most often co-reported with OR12D1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OR12D1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OR12D1 (see Related Genes above), that are NOT already directly curated for OR12D1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OR12D1.

OR12D1 (olfactory receptor family 12 subfamily D member 1 (gene/pseudogene))

Save This Analysis