OR10J5 (olfactory receptor family 10 subfamily J member 5)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 127385
• Gene name: Olfactory receptor family 10 subfamily J member 5
• Gene symbol: OR10J5
• Synonyms (NCBI Gene): MOR23, OLFR16, OR1-28
• Chromosome: 1
• Chromosome location: 1q23.2
• Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IDA	25791473
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IMP	28842679
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28842679
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	28842679
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0007608	Process	Sensory perception of smell	IDA	25791473
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0045765	Process	Regulation of angiogenesis	IMP	25791473
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IBA
GO:0051147	Process	Regulation of muscle cell differentiation	IEA
GO:0051147	Process	Regulation of muscle cell differentiation	ISS
GO:0055088	Process	Lipid homeostasis	IEA
GO:0055088	Process	Lipid homeostasis	IMP	28842679

Other IDs

• MIM: 619546
• HGNC: 14993
• e!Ensembl: ENSG00000184155

Protein

• UniProt ID: Q8NHC4
• Protein name: Olfactory receptor 10J5 (Olfactory receptor OR1-28)
• Protein function: Olfactory receptor. Activated by the synthetic floral odorant, lyral, and by alpha-cedrene, a sesquiterpene constituent of cedarwood oil. Its activation increases intracellular Ca(2+) (PubMed:25791473, PubMed:28842679). Acts as a key regulator o
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13853	7tm_4	31 → 307	Olfactory receptor	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in both the aorta, the coronary artery and umbilical vein endothelial cells (HUVECs) (at protein level). {ECO:0000269|PubMed:25791473}.
• Sequence:

  MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMY
  FFLSMLASSETVYTLVIVPRMLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGY
  DRYVAICRPLRYTVIMSKGLCAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDI
  YPVMKLSCIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTFATC
  VSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTIITPLLNPVVYSLRNKEVKDAL
  CRVVGRNIS

• Sequence length: 309

Pathways

KEGG Pathway:

Olfactory transduction

Reactome Pathway:

Olfactory Signaling Pathway

Related Genes

No strongly related genes found yet for OR10J5.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OR10J5.