Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	219870
Gene name	Olfactory receptor family 10 subfamily G member 9
Gene symbol	OR10G9
Synonyms (NCBI Gene)	OR10G10P
Chromosome	11
Chromosome location	11q24.2
Summary	Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8NGN4

Protein name

Olfactory receptor 10G9 (Olfactory receptor 10G10)

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13853	7tm_4	29 → 304	Olfactory receptor	Family

Sequence

MSKTSLVTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD
RYLAISYPLRYTSMMSGSRCALLATSTWLSGSLHSAVQTILTFHLPYCGPNQIQHYLCDA
PPILKLACADTSANEMVIFVDIGLVASGCFLLIVLSYVSIVCSILRIHTSEGRHRAFQTC
ASHCIVVLCFFVPCVFIYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK
LRDKVAHSQGE

Sequence length

311

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Olfactory transduction	Olfactory Signaling Pathway

Related Genes Genes most often co-reported with OR10G9 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OR10G9.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OR10G9 (see Related Genes above), that are NOT already directly curated for OR10G9 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OR10G9.

OR10G9 (olfactory receptor family 10 subfamily G member 9)

Save This Analysis