OR10A5 (olfactory receptor family 10 subfamily A member 5)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 144124
Gene name Olfactory receptor family 10 subfamily A member 5
Gene symbol OR10A5
Synonyms (NCBI Gene)
JCG6OR10A1OR11-403
Chromosome 11
Chromosome location 11p15.4
Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004984 Function Olfactory receptor activity IBA
GO:0004984 Function Olfactory receptor activity IEA
GO:0004984 Function Olfactory receptor activity NAS 9787077
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608493 15131 ENSG00000166363
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H207
Protein name Olfactory receptor 10A5 (HP3) (Olfactory receptor 10A1) (Olfactory receptor 11-403) (OR11-403) (Olfactory receptor-like protein JCG6)
Protein function Odorant receptor (Potential). May be involved in taste perception.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13853 7tm_4 32 → 309 Olfactory receptor Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the tongue.
Sequence 
MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMA
YDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFC
DSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFS
TCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKN
ALSRTFHKVLALRNCIP
Sequence length 317
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Olfactory transduction Olfactory Signaling Pathway

No strongly related genes found yet for OR10A5.

No additional diseases found yet through genes similar to OR10A5.