OPALIN (oligodendrocytic myelin paranodal and inner loop protein)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 93377
• Gene name: Oligodendrocytic myelin paranodal and inner loop protein
• Gene symbol: OPALIN
• Synonyms (NCBI Gene): HTMP10, TMEM10, TMP10
• Chromosome: 10
• Chromosome location: 10q24.1

miRNA Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT645823	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT645822	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT645823	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT645822	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT1204057	hsa-miR-1224-5p	CLIP-seq
MIRT1204058	hsa-miR-1245	CLIP-seq
MIRT1204059	hsa-miR-1252	CLIP-seq
MIRT1204060	hsa-miR-1304	CLIP-seq
MIRT1204061	hsa-miR-1913	CLIP-seq
MIRT1204062	hsa-miR-202	CLIP-seq
MIRT1204063	hsa-miR-3154	CLIP-seq
MIRT1204064	hsa-miR-324-3p	CLIP-seq
MIRT1204065	hsa-miR-346	CLIP-seq
MIRT1204066	hsa-miR-3915	CLIP-seq
MIRT1204067	hsa-miR-3928	CLIP-seq
MIRT1204068	hsa-miR-4257	CLIP-seq
MIRT1204069	hsa-miR-4689	CLIP-seq
MIRT1204070	hsa-miR-4769-3p	CLIP-seq
MIRT1204071	hsa-miR-640	CLIP-seq
MIRT1204072	hsa-let-7a	CLIP-seq
MIRT1204073	hsa-let-7b	CLIP-seq
MIRT1204074	hsa-let-7c	CLIP-seq
MIRT1204075	hsa-let-7d	CLIP-seq
MIRT1204076	hsa-let-7e	CLIP-seq
MIRT1204077	hsa-let-7f	CLIP-seq
MIRT1204078	hsa-let-7g	CLIP-seq
MIRT1204079	hsa-let-7i	CLIP-seq
MIRT1204080	hsa-miR-147	CLIP-seq
MIRT1204081	hsa-miR-3185	CLIP-seq
MIRT1204082	hsa-miR-3529	CLIP-seq
MIRT1204083	hsa-miR-361-5p	CLIP-seq
MIRT1204084	hsa-miR-3650	CLIP-seq
MIRT1204085	hsa-miR-379	CLIP-seq
MIRT1204086	hsa-miR-3911	CLIP-seq
MIRT1204087	hsa-miR-3934	CLIP-seq
MIRT1204088	hsa-miR-3942-5p	CLIP-seq
MIRT1204089	hsa-miR-4269	CLIP-seq
MIRT1204090	hsa-miR-4451	CLIP-seq
MIRT1204091	hsa-miR-4458	CLIP-seq
MIRT1204092	hsa-miR-4476	CLIP-seq
MIRT1204093	hsa-miR-4500	CLIP-seq
MIRT1204094	hsa-miR-4514	CLIP-seq
MIRT1204095	hsa-miR-4536	CLIP-seq
MIRT1204096	hsa-miR-4650-3p	CLIP-seq
MIRT1204097	hsa-miR-4692	CLIP-seq
MIRT1204098	hsa-miR-4703-5p	CLIP-seq
MIRT1204099	hsa-miR-4717-5p	CLIP-seq
MIRT1204100	hsa-miR-4742-5p	CLIP-seq
MIRT1204101	hsa-miR-4747-5p	CLIP-seq
MIRT1204102	hsa-miR-644	CLIP-seq
MIRT1204103	hsa-miR-98	CLIP-seq
MIRT1204072	hsa-let-7a	CLIP-seq
MIRT1204073	hsa-let-7b	CLIP-seq
MIRT1204074	hsa-let-7c	CLIP-seq
MIRT1204075	hsa-let-7d	CLIP-seq
MIRT1204076	hsa-let-7e	CLIP-seq
MIRT1204077	hsa-let-7f	CLIP-seq
MIRT1204078	hsa-let-7g	CLIP-seq
MIRT1204079	hsa-let-7i	CLIP-seq
MIRT1204081	hsa-miR-3185	CLIP-seq
MIRT1204091	hsa-miR-4458	CLIP-seq
MIRT1204092	hsa-miR-4476	CLIP-seq
MIRT1204093	hsa-miR-4500	CLIP-seq
MIRT1204101	hsa-miR-4747-5p	CLIP-seq
MIRT1204103	hsa-miR-98	CLIP-seq
MIRT2058952	hsa-miR-4263	CLIP-seq
MIRT2287042	hsa-miR-3920	CLIP-seq
MIRT2287043	hsa-miR-4731-3p	CLIP-seq
MIRT2287044	hsa-miR-4801	CLIP-seq
MIRT2455637	hsa-miR-1238	CLIP-seq
MIRT2455638	hsa-miR-3183	CLIP-seq
MIRT2455639	hsa-miR-3691-3p	CLIP-seq
MIRT2455640	hsa-miR-4292	CLIP-seq
MIRT2455641	hsa-miR-4723-3p	CLIP-seq
MIRT2455642	hsa-miR-4727-5p	CLIP-seq
MIRT1204070	hsa-miR-4769-3p	CLIP-seq
MIRT2455643	hsa-miR-515-5p	CLIP-seq
MIRT2455644	hsa-miR-544	CLIP-seq

Gene ontology (GO) Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0044291	Component	Cell-cell contact zone	IBA
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0048713	Process	Regulation of oligodendrocyte differentiation	IEA
GO:0048713	Process	Regulation of oligodendrocyte differentiation	ISS

Other IDs

• MIM: 617200
• HGNC: 20707
• e!Ensembl: ENSG00000197430

Protein

• UniProt ID: Q96PE5
• Protein name: Opalin (Oligodendrocytic myelin paranodal and inner loop protein) (Transmembrane protein 10)
• Protein function: Central nervous system-specific myelin protein that increase myelin genes expression during oligodendrocyte differentiation. Promotes oligodendrocyte terminal differentiation.
• Tissue specificity: TISSUE SPECIFICITY: Brain specific; expressed in oligodendrocytes (PubMed:11814680, PubMed:30837646). Expressed in oligodendrocytes in remyelinating multiple sclerosis plaques (PubMed:30837646). {ECO:0000269|PubMed:11814680, ECO:0000269|PubMed:30837646}.
• Sequence:

  MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI
  EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR
  PTIEMERRRGLWWLVPRLSLE

• Sequence length: 141

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
DEMENTIA	—	GWAS catalog	39046104	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30837646		★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34516348	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35358005	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for OPALIN.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OPALIN.