OOSP4B (oocyte secreted protein family member 4B)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 107987155 |
| Gene name | Oocyte secreted protein family member 4B |
| Gene symbol | OOSP4B |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 11 |
| Chromosome location | 11q12.1 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A2R8Y4Y8 |
| Protein name | Oocyte-secreted protein 4B |
| Family and domains | |
| Sequence |
MKTSVLLAITAMCSDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPV |
| Sequence length | 160 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with OOSP4B across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to OOSP4B (see Related Genes above), that are NOT already directly curated for OOSP4B itself -- a lead worth checking, not a confirmed association.
0
|
|