OOSP2 (oocyte secreted protein 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 219990
Gene name Oocyte secreted protein 2
Gene symbol OOSP2
Synonyms (NCBI Gene)
OOSP2APLAC1LTMEM122
Chromosome 11
Chromosome location 11q12.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001556 Process Oocyte maturation IMP 36042231
GO:0005515 Function Protein binding IPI 32814053
GO:0005576 Component Extracellular region IEA
GO:0005737 Component Cytoplasm IDA 31429579
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620263 26699 ENSG00000149507
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86WS3
Protein name Oocyte-secreted protein 2 (Placenta-specific 1-like protein) (Protein TMEM122)
Protein function Involved in oocyte maturation.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in oocytes. {ECO:0000269|PubMed:36042231}.
Sequence 
MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPAN
RIHTYVYEFIYLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW
LTPVSTENEIKLDPSPFIADFQTTAEELGLLSSSPNLL
Sequence length 158
Interactions View interactions

No strongly related genes found yet for OOSP2.

No additional diseases found yet through genes similar to OOSP2.