OMP (olfactory marker protein)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4975
• Gene name: Olfactory marker protein
• Gene symbol: OMP
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11q13.5
• Summary: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse k

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8790421
GO:0007268	Process	Chemical synaptic transmission	TAS	8790421
GO:0007608	Process	Sensory perception of smell	IBA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	TAS	8790421
GO:0022008	Process	Neurogenesis	IEA
GO:0030424	Component	Axon	IBA
GO:0030424	Component	Axon	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0045202	Component	Synapse	IEA

Other IDs

• MIM: 164340
• HGNC: 8136
• e!Ensembl: ENSG00000254550

Protein

• UniProt ID: P47874
• Protein name: Olfactory marker protein (Olfactory neuronal-specific protein)
• Protein function: May act as a modulator of the olfactory signal-transduction cascade.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06554	Olfactory_mark	11 → 161	Olfactory marker protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Uniquely associated with mature olfactory receptor neurons.
• Sequence:

  MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQ
  QRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEA
  DALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

• Sequence length: 163

Related Genes

No strongly related genes found yet for OMP.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OMP.