Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	118427
Gene name	Olfactomedin 3
Gene symbol	OLFM3
Synonyms (NCBI Gene)	NOE3NOELIN3OPTIMEDIN
Chromosome	1
Chromosome location	1p21.1

18 Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439119	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439119	hsa-miR-10b-5p	3'LIFE	25074381
MIRT1203100	hsa-miR-4662a-5p	CLIP-seq
MIRT2058633	hsa-miR-1208	CLIP-seq
MIRT2058634	hsa-miR-3127-5p	CLIP-seq
MIRT2058635	hsa-miR-452	CLIP-seq
MIRT2058636	hsa-miR-4676-3p	CLIP-seq
MIRT2058634	hsa-miR-3127-5p	CLIP-seq
MIRT2585169	hsa-miR-190	CLIP-seq
MIRT2585170	hsa-miR-190b	CLIP-seq
MIRT2585171	hsa-miR-4645-3p	CLIP-seq
MIRT2585172	hsa-miR-4802-5p	CLIP-seq
MIRT2585173	hsa-miR-548p	CLIP-seq
MIRT2585169	hsa-miR-190	CLIP-seq
MIRT2585170	hsa-miR-190b	CLIP-seq
MIRT2585171	hsa-miR-4645-3p	CLIP-seq
MIRT2585172	hsa-miR-4802-5p	CLIP-seq
MIRT2585173	hsa-miR-548p	CLIP-seq

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12019210, 25416956, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0032281	Component	AMPA glutamate receptor complex	IEA
GO:0042462	Process	Eye photoreceptor cell development	IEA
GO:0045202	Component	Synapse	IEA

MIM	HGNC	e!Ensembl
607567	17990	ENSG00000118733

Q96PB7

Protein name

Noelin-3 (Olfactomedin-3) (Optimedin)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02191	OLF	222 → 468	Olfactomedin-like domain	Family
PF12308	Noelin-1	46 → 145	Neurogenesis glycoprotein	Family

Tissue specificity

TISSUE SPECIFICITY: In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung. {ECO:0000269|PubMed:12019210}.

Sequence

MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTLTQISPKEGWQVYSSAQD
PDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQ
MKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNL
SAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPVTVKTSGTRFGA
WMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
SLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVY
ATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY
STKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT

Sequence length

478

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (12)
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	34099189	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	30833571	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISEASE OF PERITONEUM	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	40341939	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	31969693, 34099189	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	29449654, 36777996, 37386247	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	34099189, 35396580	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Strabismus, susceptibility to	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	27927641	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	28222112	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (7)
Alzheimer Disease	Alzheimer disease	Pubtator	32711556	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24511991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	24511991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37800791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24511991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22281030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37800791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

OLFM3 (olfactomedin 3)

Bookmark This Gene