Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	170392
Gene name	Oncoprotein induced transcript 3
Gene symbol	OIT3
Synonyms (NCBI Gene)	LZP
Chromosome	10
Chromosome location	10q22.1
Summary	This gene was identified due to its downregulation in hepatocarcinomas. The encoded protein may be involved in liver development and function. [provided by RefSeq, Sep 2016]

17 Show/Hide all (17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT449981	hsa-miR-296-3p	PAR-CLIP	22100165
MIRT449980	hsa-miR-5087	PAR-CLIP	22100165
MIRT449979	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT449981	hsa-miR-296-3p	PAR-CLIP	22100165
MIRT449980	hsa-miR-5087	PAR-CLIP	22100165
MIRT449979	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT1202925	hsa-miR-202	CLIP-seq
MIRT1202926	hsa-miR-4280	CLIP-seq
MIRT1202927	hsa-miR-4496	CLIP-seq
MIRT1202928	hsa-miR-4678	CLIP-seq
MIRT1202929	hsa-miR-595	CLIP-seq
MIRT2585160	hsa-miR-219-1-3p	CLIP-seq
MIRT2585161	hsa-miR-3174	CLIP-seq
MIRT2585162	hsa-miR-3907	CLIP-seq
MIRT2585163	hsa-miR-4731-5p	CLIP-seq
MIRT2585164	hsa-miR-571	CLIP-seq
MIRT2585165	hsa-miR-759	CLIP-seq

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003014	Process	Renal system process	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0009986	Component	Cell surface	IBA

MIM	HGNC	e!Ensembl
609330	29953	ENSG00000138315

Q8WWZ8

Protein name

Oncoprotein-induced transcript 3 protein (Liver-specific zona pellucida domain-containing protein)

Protein function

May be involved in hepatocellular function and development.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00100	Zona_pellucida	268 → 514	Zona pellucida-like domain	Family
PF14670	FXa_inhibition	227 → 262		Domain
PF14670	FXa_inhibition	186 → 221		Domain

Tissue specificity

TISSUE SPECIFICITY: Liver-specific. Expressed only in the hepatocytes. Down-regulated in hepatocellular carcinoma (HCC) and HCC cell lines. {ECO:0000269|PubMed:12939600}.

Sequence

MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWY
HFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDVEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVNIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPVVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQGQTLTGGPIR
IDWED

Sequence length

545

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	28284560	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	33020668, 36474045	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (10)
Anaplasia	Anaplasia	BEFREE	12939600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35353239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35353239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	32569156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	LHGDN	15589826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12939600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25824785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25824785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25824785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with OIT3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OIT3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OIT3 (see Related Genes above), that are NOT already directly curated for OIT3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OIT3.

OIT3 (oncoprotein induced transcript 3)

Bookmark This Gene