Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	11054
Gene name	Opioid growth factor receptor
Gene symbol	OGFR
Synonyms (NCBI Gene)	-
Chromosome	20
Chromosome location	20q13.33
Summary	The protein encoded by this gene is a receptor for opioid growth factor (OGF), also known as [Met(5)]-enkephalin. OGF is a negative regulator of cell proliferation and tissue organization in a variety of processes. The encoded unbound receptor for OGF has

56 Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030571	hsa-miR-24-3p	Microarray	19748357
MIRT049442	hsa-miR-92a-3p	CLASH	23622248
MIRT041038	hsa-miR-505-3p	CLASH	23622248
MIRT040609	hsa-miR-92b-3p	CLASH	23622248
MIRT040224	hsa-miR-615-3p	CLASH	23622248
MIRT037703	hsa-miR-744-5p	CLASH	23622248
MIRT1202754	hsa-miR-105	CLIP-seq
MIRT1202755	hsa-miR-1245b-5p	CLIP-seq
MIRT1202756	hsa-miR-1273e	CLIP-seq
MIRT1202757	hsa-miR-3142	CLIP-seq
MIRT1202758	hsa-miR-3646	CLIP-seq
MIRT1202759	hsa-miR-3677-5p	CLIP-seq
MIRT1202760	hsa-miR-3973	CLIP-seq
MIRT1202761	hsa-miR-4318	CLIP-seq
MIRT1202762	hsa-miR-4459	CLIP-seq
MIRT1202763	hsa-miR-4695-5p	CLIP-seq
MIRT1202764	hsa-miR-4758-3p	CLIP-seq
MIRT1202765	hsa-miR-520g	CLIP-seq
MIRT1202766	hsa-miR-520h	CLIP-seq
MIRT1202767	hsa-miR-663b	CLIP-seq
MIRT2058566	hsa-miR-103a	CLIP-seq
MIRT2058567	hsa-miR-107	CLIP-seq
MIRT2058568	hsa-miR-1184	CLIP-seq
MIRT2058569	hsa-miR-1203	CLIP-seq
MIRT2058570	hsa-miR-1293	CLIP-seq
MIRT2058571	hsa-miR-2110	CLIP-seq
MIRT2058572	hsa-miR-214	CLIP-seq
MIRT2058573	hsa-miR-3619-5p	CLIP-seq
MIRT2058574	hsa-miR-4271	CLIP-seq
MIRT1202762	hsa-miR-4459	CLIP-seq
MIRT2058575	hsa-miR-4483	CLIP-seq
MIRT2058576	hsa-miR-4660	CLIP-seq
MIRT2058577	hsa-miR-4725-3p	CLIP-seq
MIRT2058578	hsa-miR-4751	CLIP-seq
MIRT2058579	hsa-miR-4755-3p	CLIP-seq
MIRT2058580	hsa-miR-491-5p	CLIP-seq
MIRT2058581	hsa-miR-520d-5p	CLIP-seq
MIRT2058582	hsa-miR-524-5p	CLIP-seq
MIRT2058583	hsa-miR-646	CLIP-seq
MIRT2058584	hsa-miR-7	CLIP-seq
MIRT2058585	hsa-miR-761	CLIP-seq
MIRT2058570	hsa-miR-1293	CLIP-seq
MIRT2286774	hsa-miR-1909	CLIP-seq
MIRT2058571	hsa-miR-2110	CLIP-seq
MIRT2286775	hsa-miR-3175	CLIP-seq
MIRT2286776	hsa-miR-3188	CLIP-seq
MIRT2058574	hsa-miR-4271	CLIP-seq
MIRT1202761	hsa-miR-4318	CLIP-seq
MIRT1202762	hsa-miR-4459	CLIP-seq
MIRT2058575	hsa-miR-4483	CLIP-seq
MIRT2286777	hsa-miR-4487	CLIP-seq
MIRT1202763	hsa-miR-4695-5p	CLIP-seq
MIRT2058577	hsa-miR-4725-3p	CLIP-seq
MIRT2058580	hsa-miR-491-5p	CLIP-seq
MIRT2286778	hsa-miR-544	CLIP-seq
MIRT2058584	hsa-miR-7	CLIP-seq

7 Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	10677613
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0140625	Function	Opioid growth factor receptor activity	IEA

MIM	HGNC	e!Ensembl
606459	15768	ENSG00000060491

Q9NZT2

Protein name

Opioid growth factor receptor (OGFr) (Protein 7-60) (Zeta-type opioid receptor)

Protein function

Receptor for opioid growth factor (OGF), also known as Met-enkephalin. Seems to be involved in growth regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04664	OGFr_N	86 → 293	Opioid growth factor receptor (OGFr) conserved region	Family
PF04680	OGFr_III	537 → 556	Opioid growth factor receptor repeat	Repeat
PF04680	OGFr_III	557 → 576	Opioid growth factor receptor repeat	Repeat
PF04680	OGFr_III	597 → 616	Opioid growth factor receptor repeat	Repeat
PF04680	OGFr_III	617 → 636	Opioid growth factor receptor repeat	Repeat
PF04680	OGFr_III	517 → 536	Opioid growth factor receptor repeat	Repeat
PF04680	OGFr_III	577 → 596	Opioid growth factor receptor repeat	Repeat
PF04680	OGFr_III	637 → 656	Opioid growth factor receptor repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the heart and liver, moderately in skeletal muscle and kidney and to a lesser extent in brain and pancreas. Expressed in fetal tissues including liver and kidney.

Sequence

MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRM
TGSRNWRATRDMCRYRHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDN
YDLLEDNHSYIQWLFPLREPGVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGI
RLEDRGTGTVGRAQNYQKRFQNLNWRSHNNLRITRILKSLGELGLEHFQAPLVRFFLEET
LVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRPRCKFVWGPQDKLRRFKPSSL
PHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSVEPQDAGPLER
SQGDEAGGHGEDRPEPLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALS
QGSLRTGTQEVGGQDPGEAVQPCRQPLGARVADKVRKRRKVDEGAGDSAAVASGGAQTLA
LAGSPAPSGHPKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPSPAGPAGDEPAESPSE
TPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSE
TPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAKAGEA
AELQDAEVESSAKSGKP

Sequence length

677

Interactions

View interactions

KEGG Pathway
Neuroactive ligand-receptor interaction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (30)
Adenocarcinoma	Adenocarcinoma	BEFREE	27167686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	19923357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	19835629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19923357, 29079719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27167686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19297547, 31496722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	19923357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16820893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31496722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	19835629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19923357, 29079719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19923357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27167686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19297547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18636152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19835629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19835629, 27167686, 31408839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	29030229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	29030229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18636152, 31408839		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19297547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19297547, 23856908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18636152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18636152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18190706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19835629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27167686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12655527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12655527, 16685459, 21584896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19835629		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with OGFR across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OGFR.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OGFR (see Related Genes above), that are NOT already directly curated for OGFR itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OGFR.

OGFR (opioid growth factor receptor)

Save This Analysis