OGFOD3 (2-oxoglutarate and iron dependent oxygenase domain containing 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 79701
Gene name 2-oxoglutarate and iron dependent oxygenase domain containing 3
Gene symbol OGFOD3
Synonyms (NCBI Gene)
C17orf101
Chromosome 17
Chromosome location 17q25.3
miRNA miRNA information provided by mirtarbase database.
16 Show/Hide all (16)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT677133 hsa-miR-4722-3p HITS-CLIP 23824327
MIRT677132 hsa-miR-6727-3p HITS-CLIP 23824327
MIRT677131 hsa-miR-6747-3p HITS-CLIP 23824327
MIRT677130 hsa-miR-3653-5p HITS-CLIP 23824327
MIRT677129 hsa-miR-1976 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005506 Function Iron ion binding IEA
GO:0016020 Component Membrane HDA 19946888
GO:0016020 Component Membrane IEA
GO:0016491 Function Oxidoreductase activity IEA
GO:0016705 Function Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6PK18
Protein name 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (EC 1.14.11.-)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13640 2OG-FeII_Oxy_3 213 → 306 2OG-Fe(II) oxygenase superfamily Domain
Sequence 
MAPQRRAATKAPEGNGAAERRNRSSTKKDRAPREVQRLWQRPWLRTAGLGAGFVLTALLL
WSSLGADDGVAEVLARRGEVVAGRFIEVPCSEDYDSHRRFEGCTPRKCGRGVTDVVITRE
EAERIRSVAEKGLSLGGSDGGASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRL
YREVRQKVQLTIAEAFGISASSLHLTKPTFFSRINSTEARTAHDEYWHAHVDKVTYGSFD
YTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFFTSGSENLHRVEKVHWGTRYA
ITIAFSCNPDHGIEDPAFP
Sequence length 319
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Cervical cancer Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Neoplasms Colorectal neoplasm Pubtator 30396175 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Dyslipidemias Dyslipidemias BEFREE 29126409
★★★★★
★☆☆☆☆
Found in Text Mining only
Dyslipidemias Dyslipidemias Pubtator 29126409 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for OGFOD3.

No additional diseases found yet through genes similar to OGFOD3.