Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	29991
Gene name	Odorant binding protein 2A
Gene symbol	OBP2A
Synonyms (NCBI Gene)	LCN13OBPOBP2COBPIIahOBPIIa
Chromosome	9
Chromosome location	9q34.3
Summary	This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scave

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005549	Function	Odorant binding	IDA	16546182
GO:0005549	Function	Odorant binding	NAS	10607840
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0007606	Process	Sensory perception of chemical stimulus	TAS	10607840
GO:0007608	Process	Sensory perception of smell	IEA
GO:0036094	Function	Small molecule binding	IEA
GO:0042593	Process	Glucose homeostasis	ISS

MIM	HGNC	e!Ensembl
164320	23380	ENSG00000122136

Q9NY56

Protein name

Odorant-binding protein 2a (Odorant-binding protein IIa) (OBPIIa)

Protein function

Binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids, including undecanal, palmitic acid, efficient aldehydes, benzenic aldehydes, heterocyclic aldehydes and aliphatic acids. {ECO:0

PDB

4RUN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	26 → 164	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung (PubMed:10607840). Expressed in the liver (PubMed:27827363). {ECO:0000269|PubMed:10607840, ECO:0000269|PubMed:27827363}.

Sequence

MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGG
NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRG
GLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH

Sequence length

170

Interactions

View interactions

Related Genes Genes most often co-reported with OBP2A across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for OBP2A.

Diseases Linked via Similar Genes Diseases curated for genes most similar to OBP2A (see Related Genes above), that are NOT already directly curated for OBP2A itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to OBP2A.

OBP2A (odorant binding protein 2A)

Save This Analysis