OAZ3 (ornithine decarboxylase antizyme 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51686
• Gene name: Ornithine decarboxylase antizyme 3
• Gene symbol: OAZ3
• Synonyms (NCBI Gene): AZ3, OAZ-t, TISP15
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which i

miRNA Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1201320	hsa-miR-1265	CLIP-seq
MIRT1201321	hsa-miR-2392	CLIP-seq
MIRT1201322	hsa-miR-296-5p	CLIP-seq
MIRT1201323	hsa-miR-3140-5p	CLIP-seq
MIRT1201324	hsa-miR-3688-3p	CLIP-seq
MIRT1201325	hsa-miR-384	CLIP-seq
MIRT1201326	hsa-miR-3978	CLIP-seq
MIRT1201327	hsa-miR-4532	CLIP-seq
MIRT1201328	hsa-miR-4716-5p	CLIP-seq
MIRT1201329	hsa-miR-592	CLIP-seq
MIRT1201330	hsa-miR-597	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006596	Process	Polyamine biosynthetic process	IEA
GO:0007283	Process	Spermatogenesis	TAS	10781085
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	IBA
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	IDA
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	IEA
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	ISS
GO:0008073	Function	Ornithine decarboxylase inhibitor activity	TAS	10781085
GO:0036126	Component	Sperm flagellum	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	ISS
GO:0051497	Process	Negative regulation of stress fiber assembly	IEA
GO:0071532	Function	Ankyrin repeat binding	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0075523	Process	Viral translational frameshifting	IEA
GO:0090316	Process	Positive regulation of intracellular protein transport	IEA
GO:1902268	Process	Negative regulation of polyamine transmembrane transport	IEA
GO:1902268	Process	Negative regulation of polyamine transmembrane transport	ISS

Other IDs

• MIM: 605138
• HGNC: 8097
• e!Ensembl: ENSG00000143450

Protein

• UniProt ID: Q9UMX2
• Protein name: Ornithine decarboxylase antizyme 3 (AZ3) (ODC-Az 3)
• Protein function: Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis and uptake in response to increased intracellular polyamine levels. Binds to ODC monomers, inhibiting the assembly of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02100	ODC_AZ	128 → 223	Ornithine decarboxylase antizyme	Family

• Tissue specificity: TISSUE SPECIFICITY: Testis specific.
• Sequence:

  MPCKRCRPSVYSLSYIKRGKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYK
  EEEDLTLQPRSCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDPLLHQDPVQ
  LDFHFRLTSQTSAHWHGLLCDRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVN
  FQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP

• Sequence length: 235

Pathways

Reactome Pathway:

Regulation of ornithine decarboxylase (ODC)

Related Genes

No strongly related genes found yet for OAZ3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to OAZ3.