Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9631
Gene name	Nucleoporin 155
Gene symbol	NUP155
Synonyms (NCBI Gene)	ATFB15N155
Chromosome	5
Chromosome location	5p13.2
Summary	Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the f

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777339	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant

327 Show/Hide all (327)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020631	hsa-miR-155-5p	Proteomics	18668040
MIRT032245	hsa-let-7b-5p	Proteomics	18668040
MIRT032245	hsa-let-7b-5p	CLASH	23622248
MIRT051557	hsa-let-7e-5p	CLASH	23622248
MIRT051254	hsa-miR-16-5p	CLASH	23622248
MIRT049337	hsa-miR-92a-3p	CLASH	23622248
MIRT687374	hsa-miR-1273d	HITS-CLIP	23313552
MIRT687373	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT687372	hsa-miR-3926	HITS-CLIP	23313552
MIRT687371	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT687370	hsa-miR-125a-3p	HITS-CLIP	23313552
MIRT687369	hsa-miR-764	HITS-CLIP	23313552
MIRT687368	hsa-miR-3934-5p	HITS-CLIP	23313552
MIRT687367	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT687366	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT687365	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687364	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687363	hsa-miR-4312	HITS-CLIP	23313552
MIRT687362	hsa-miR-378a-5p	HITS-CLIP	23313552
MIRT634056	hsa-miR-4267	HITS-CLIP	23824327
MIRT634055	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT634054	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT634053	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT634052	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT634051	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT634050	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT634049	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT634048	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT634047	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT634046	hsa-miR-7977	HITS-CLIP	23824327
MIRT634045	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT634044	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT634043	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT634042	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT634041	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT634040	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT634039	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT634038	hsa-miR-3689c	HITS-CLIP	23824327
MIRT634037	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT634036	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT634035	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT634034	hsa-miR-3122	HITS-CLIP	23824327
MIRT634033	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT634032	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT634031	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT506367	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT506366	hsa-miR-4458	PAR-CLIP	20371350
MIRT506365	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT506364	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT506363	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT506362	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT051557	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT506361	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT032245	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT506360	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT506359	hsa-miR-4500	PAR-CLIP	20371350
MIRT506358	hsa-miR-624-5p	PAR-CLIP	20371350
MIRT506357	hsa-miR-1244	PAR-CLIP	20371350
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT561818	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT561818	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT506367	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT506366	hsa-miR-4458	PAR-CLIP	21572407
MIRT506365	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT506364	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT506363	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT506362	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT051557	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT506361	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT032245	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT506360	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT506359	hsa-miR-4500	PAR-CLIP	21572407
MIRT506358	hsa-miR-624-5p	PAR-CLIP	21572407
MIRT506357	hsa-miR-1244	PAR-CLIP	21572407
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	21572407
MIRT462229	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT462228	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT540860	hsa-miR-4257	PAR-CLIP	21572407
MIRT540859	hsa-miR-1273g-3p	PAR-CLIP	21572407
MIRT540858	hsa-miR-4537	PAR-CLIP	21572407
MIRT540857	hsa-miR-1827	PAR-CLIP	21572407
MIRT540856	hsa-miR-377-5p	PAR-CLIP	21572407
MIRT540855	hsa-miR-6086	PAR-CLIP	21572407
MIRT540854	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT540853	hsa-miR-6499-3p	PAR-CLIP	21572407
MIRT540852	hsa-miR-638	PAR-CLIP	21572407
MIRT540851	hsa-miR-4316	PAR-CLIP	21572407
MIRT540850	hsa-miR-1294	PAR-CLIP	21572407
MIRT540849	hsa-miR-455-3p	PAR-CLIP	21572407
MIRT540848	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT506367	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT506366	hsa-miR-4458	PAR-CLIP	23446348
MIRT506365	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT506364	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT506363	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT506362	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT051557	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT506361	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT032245	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT506360	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT506359	hsa-miR-4500	PAR-CLIP	23446348
MIRT506358	hsa-miR-624-5p	PAR-CLIP	23446348
MIRT506357	hsa-miR-1244	PAR-CLIP	23446348
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT462230	hsa-miR-302f	PAR-CLIP	23446348
MIRT462227	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT462226	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT462225	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT462224	hsa-miR-298	PAR-CLIP	23446348
MIRT462223	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT462222	hsa-miR-1273e	PAR-CLIP	23446348
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT506367	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT506366	hsa-miR-4458	PAR-CLIP	23446348
MIRT506365	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT506364	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT506363	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT506362	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT051557	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT506361	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT032245	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT506360	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT506359	hsa-miR-4500	PAR-CLIP	23446348
MIRT506358	hsa-miR-624-5p	PAR-CLIP	23446348
MIRT506357	hsa-miR-1244	PAR-CLIP	23446348
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT462236	hsa-miR-548ag	PAR-CLIP	23592263
MIRT462235	hsa-miR-548ai	PAR-CLIP	23592263
MIRT462234	hsa-miR-548ba	PAR-CLIP	23592263
MIRT462233	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT462232	hsa-miR-944	PAR-CLIP	23592263
MIRT462231	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT462230	hsa-miR-302f	PAR-CLIP	23592263
MIRT462229	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT462228	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT462227	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT462226	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT462225	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT462224	hsa-miR-298	PAR-CLIP	23592263
MIRT462223	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT462222	hsa-miR-1273e	PAR-CLIP	23592263
MIRT687374	hsa-miR-1273d	PAR-CLIP	27292025
MIRT540859	hsa-miR-1273g-3p	PAR-CLIP	27292025
MIRT540859	hsa-miR-1273g-3p	PAR-CLIP	27292025
MIRT540850	hsa-miR-1294	PAR-CLIP	27292025
MIRT462229	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT540854	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT687373	hsa-miR-3190-5p	PAR-CLIP	27292025
MIRT687372	hsa-miR-3926	PAR-CLIP	27292025
MIRT540860	hsa-miR-4257	PAR-CLIP	27292025
MIRT540851	hsa-miR-4316	PAR-CLIP	27292025
MIRT540858	hsa-miR-4537	PAR-CLIP	27292025
MIRT540858	hsa-miR-4537	PAR-CLIP	27292025
MIRT540858	hsa-miR-4537	PAR-CLIP	27292025
MIRT540849	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT540849	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT540849	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT540852	hsa-miR-638	PAR-CLIP	27292025
MIRT540852	hsa-miR-638	PAR-CLIP	27292025
MIRT540852	hsa-miR-638	PAR-CLIP	27292025
MIRT540853	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT540853	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT462228	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT540848	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT540848	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT540848	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT687374	hsa-miR-1273d	HITS-CLIP	23313552
MIRT687373	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT687372	hsa-miR-3926	HITS-CLIP	23313552
MIRT687371	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT687370	hsa-miR-125a-3p	HITS-CLIP	23313552
MIRT687369	hsa-miR-764	HITS-CLIP	23313552
MIRT687368	hsa-miR-3934-5p	HITS-CLIP	23313552
MIRT687367	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT687366	hsa-miR-3653-5p	HITS-CLIP	23313552
MIRT687365	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687364	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687363	hsa-miR-4312	HITS-CLIP	23313552
MIRT687362	hsa-miR-378a-5p	HITS-CLIP	23313552
MIRT634056	hsa-miR-4267	HITS-CLIP	23824327
MIRT634055	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT634054	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT634053	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT634052	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT634051	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT634050	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT634049	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT634048	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT634047	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT634046	hsa-miR-7977	HITS-CLIP	23824327
MIRT634045	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT634044	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT634043	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT634042	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT634041	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT634040	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT634039	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT634038	hsa-miR-3689c	HITS-CLIP	23824327
MIRT634037	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT634036	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT634035	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT634034	hsa-miR-3122	HITS-CLIP	23824327
MIRT634033	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT634032	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT634031	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT506367	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT506366	hsa-miR-4458	PAR-CLIP	20371350
MIRT506365	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT506364	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT506363	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT506362	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT051557	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT506361	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT032245	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT506360	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT506359	hsa-miR-4500	PAR-CLIP	20371350
MIRT506358	hsa-miR-624-5p	PAR-CLIP	20371350
MIRT506357	hsa-miR-1244	PAR-CLIP	20371350
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT561818	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT561818	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT506367	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT506366	hsa-miR-4458	PAR-CLIP	21572407
MIRT506365	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT506364	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT506363	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT506362	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT051557	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT506361	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT032245	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT506360	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT506359	hsa-miR-4500	PAR-CLIP	21572407
MIRT506358	hsa-miR-624-5p	PAR-CLIP	21572407
MIRT506357	hsa-miR-1244	PAR-CLIP	21572407
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	21572407
MIRT462229	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT462228	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT540860	hsa-miR-4257	PAR-CLIP	21572407
MIRT540859	hsa-miR-1273g-3p	PAR-CLIP	21572407
MIRT540858	hsa-miR-4537	PAR-CLIP	21572407
MIRT540857	hsa-miR-1827	PAR-CLIP	21572407
MIRT540856	hsa-miR-377-5p	PAR-CLIP	21572407
MIRT540855	hsa-miR-6086	PAR-CLIP	21572407
MIRT540854	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT540853	hsa-miR-6499-3p	PAR-CLIP	21572407
MIRT540852	hsa-miR-638	PAR-CLIP	21572407
MIRT540851	hsa-miR-4316	PAR-CLIP	21572407
MIRT540850	hsa-miR-1294	PAR-CLIP	21572407
MIRT540849	hsa-miR-455-3p	PAR-CLIP	21572407
MIRT540848	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT506367	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT506366	hsa-miR-4458	PAR-CLIP	23446348
MIRT506365	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT506364	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT506363	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT506362	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT051557	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT506361	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT032245	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT506360	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT506359	hsa-miR-4500	PAR-CLIP	23446348
MIRT506358	hsa-miR-624-5p	PAR-CLIP	23446348
MIRT506357	hsa-miR-1244	PAR-CLIP	23446348
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT462230	hsa-miR-302f	PAR-CLIP	23446348
MIRT462227	hsa-miR-6840-3p	PAR-CLIP	23446348
MIRT462226	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT462225	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT462224	hsa-miR-298	PAR-CLIP	23446348
MIRT462223	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT462222	hsa-miR-1273e	PAR-CLIP	23446348
MIRT506369	hsa-miR-196b-5p	PAR-CLIP	23446348
MIRT506368	hsa-miR-196a-5p	PAR-CLIP	23446348
MIRT506367	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT506366	hsa-miR-4458	PAR-CLIP	23446348
MIRT506365	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT506364	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT506363	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT506362	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT051557	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT506361	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT032245	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT506360	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT506359	hsa-miR-4500	PAR-CLIP	23446348
MIRT506358	hsa-miR-624-5p	PAR-CLIP	23446348
MIRT506357	hsa-miR-1244	PAR-CLIP	23446348
MIRT506356	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT462236	hsa-miR-548ag	PAR-CLIP	23592263
MIRT462235	hsa-miR-548ai	PAR-CLIP	23592263
MIRT462234	hsa-miR-548ba	PAR-CLIP	23592263
MIRT462233	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT462232	hsa-miR-944	PAR-CLIP	23592263
MIRT462231	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT462230	hsa-miR-302f	PAR-CLIP	23592263
MIRT462229	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT462228	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT462227	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT462226	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT462225	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT462224	hsa-miR-298	PAR-CLIP	23592263
MIRT462223	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT462222	hsa-miR-1273e	PAR-CLIP	23592263
MIRT1199058	hsa-miR-4682	CLIP-seq
MIRT1199059	hsa-miR-548ad	CLIP-seq
MIRT1199060	hsa-miR-548l	CLIP-seq
MIRT1199061	hsa-miR-711	CLIP-seq
MIRT1199062	hsa-miR-3074-3p	CLIP-seq
MIRT1199059	hsa-miR-548ad	CLIP-seq
MIRT1199060	hsa-miR-548l	CLIP-seq
MIRT2286082	hsa-miR-128	CLIP-seq
MIRT2286083	hsa-miR-27a	CLIP-seq
MIRT2286084	hsa-miR-27b	CLIP-seq
MIRT1199062	hsa-miR-3074-3p	CLIP-seq
MIRT1199060	hsa-miR-548l	CLIP-seq

29 Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000972	Process	Transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 29568061, 30488537
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	19070573, 24315095
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IEA
GO:0005643	Component	Nuclear pore	NAS	24315095
GO:0005829	Component	Cytosol	TAS
GO:0006405	Process	RNA export from nucleus	IBA
GO:0006406	Process	MRNA export from nucleus	IEA
GO:0006606	Process	Protein import into nucleus	IBA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0006913	Process	Nucleocytoplasmic transport	NAS	27016207
GO:0006998	Process	Nuclear envelope organization	IDA	19070573
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0017056	Function	Structural constituent of nuclear pore	IBA
GO:0017056	Function	Structural constituent of nuclear pore	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0031965	Component	Nuclear membrane	IEA
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0035196	Process	MiRNA processing	IEA
GO:0036228	Process	Protein localization to nuclear inner membrane	IBA
GO:0044611	Component	Nuclear pore inner ring	IBA
GO:0051028	Process	MRNA transport	IEA
GO:0086014	Process	Atrial cardiac muscle cell action potential	IEA

MIM	HGNC	e!Ensembl
606694	8063	ENSG00000113569

O75694

Protein name

Nuclear pore complex protein Nup155 (155 kDa nucleoporin) (Nucleoporin Nup155)

Protein function

Essential component of nuclear pore complex. Could be essessential for embryogenesis. Nucleoporins may be involved both in binding and translocating proteins during nucleocytoplasmic transport.

PDB

5A9Q , 5IJN , 5IJO , 7EYE , 7EYF , 7EYQ , 7PER , 7R1Y , 7R5J , 7R5K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03177	Nucleoporin_C	739 → 1200	Non-repetitive/WGA-negative nucleoporin C-terminal	Family
PF08801	Nucleoporin_N	77 → 510	Nup133 N terminal like	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGM
SDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTID
SDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSY
ANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVI
QVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLA
VTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLM
AASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFK
LHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGS
PVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYS
GKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQA
IQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIAS
LINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRES
LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHF
EQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDL
LWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEF
LHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE
CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPR
FFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKP
LHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNF
KSLQAKLERLH

Sequence length

1391

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Nucleocytoplasmic transport	ISG15 antiviral mechanism
Amyotrophic lateral sclerosis	Transport of the SLBP independent Mature mRNA
	Transport of the SLBP Dependant Mature mRNA
	Transport of Mature mRNA Derived from an Intronless Transcript
	Transport of Mature mRNA derived from an Intron-Containing Transcript
	Rev-mediated nuclear export of HIV RNA
	Transport of Ribonucleoproteins into the Host Nucleus
	NS1 Mediated Effects on Host Pathways
	Viral Messenger RNA Synthesis
	NEP/NS2 Interacts with the Cellular Export Machinery
	Regulation of Glucokinase by Glucokinase Regulatory Protein
	Vpr-mediated nuclear import of PICs
	snRNP Assembly
	SUMOylation of DNA damage response and repair proteins
	SUMOylation of ubiquitinylation proteins
	Nuclear Pore Complex (NPC) Disassembly
	Regulation of HSF1-mediated heat shock response
	SUMOylation of SUMOylation proteins
	SUMOylation of chromatin organization proteins
	SUMOylation of RNA binding proteins
	SUMOylation of DNA replication proteins
	Transcriptional regulation by small RNAs
	Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
	tRNA processing in the nucleus
	HCMV Early Events
	HCMV Late Events
	Postmitotic nuclear pore complex (NPC) reformation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Atrial fibrillation, familial, 15	Pathogenic	rs587777339	RCV000114997	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (33)
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL 1	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 10	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 11	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 12	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 13	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 14	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 2	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 3	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 4	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 5	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 6	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 7	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 8	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 9	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ATRIAL FIBRILLATION	—	GWAS catalog	19070573	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY ATRIAL FIBRILLATION	—	Orphanet	19070573	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NUP155-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian insufficiency	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (18)
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	25602437, 27707468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	19070573, 29848314, 30488537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	LHGDN	19070573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	21924735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRIAL FIBRILLATION, FAMILIAL, 1 (disorder)	Atrial Fibrillation	ORPHANET_DG	19070573		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRIAL FIBRILLATION, FAMILIAL, 15	Atrial Fibrillation	UNIPROT_DG	19070573		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ATRIAL FIBRILLATION, FAMILIAL, 15	Atrial Fibrillation	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
ATRIAL FIBRILLATION, FAMILIAL, 15	Atrial Fibrillation	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Brugada Syndrome	Brugada syndrome	Pubtator	27707468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	19070573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19070573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial atrial fibrillation	Atrial Fibrillation	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	19505846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	32026199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31089132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31089132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23872305		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
NUP35	[]	28	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP205	[]	28	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP188	[]	28	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NDC1	[]	28	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]
NUP93	[]	28	["Nucleocytoplasmic transport","Regulation of HSF1-mediated heat shock response","HCMV Late Events","SUMOylation of DNA damage response and repair proteins","SUMOylation of chromatin organization proteins","SUMOylation of RNA binding proteins","snRNP Assembly","HCMV Early Events","Transport of the SLBP independent Mature mRNA","Transport of the SLBP Dependant Mature mRNA","Transport of Mature mRNA Derived from an Intronless Transcript","Transport of Mature mRNA derived from an Intron-Containing Transcript"]	[]

NUP155 (nucleoporin 155)

Bookmark This Gene