NUDT10 (nudix hydrolase 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 170685
• Gene name: Nudix hydrolase 10
• Gene symbol: NUDT10
• Synonyms (NCBI Gene): APS2, DIPP3-alpha, DIPP3a
• Chromosome: X
• Chromosome location: Xp11.22
• Summary: This gene is a member of the nudix (nucleoside diphosphate linked moiety X)-type motif containing family. The encoded protein is a phosphohydrolase and may regulate the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphos

miRNA Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1197431	hsa-miR-1224-5p	CLIP-seq
MIRT1197432	hsa-miR-127-5p	CLIP-seq
MIRT1197433	hsa-miR-2964a-5p	CLIP-seq
MIRT1197434	hsa-miR-3065-5p	CLIP-seq
MIRT1197435	hsa-miR-3618	CLIP-seq
MIRT1197436	hsa-miR-362-5p	CLIP-seq
MIRT1197437	hsa-miR-3668	CLIP-seq
MIRT1197438	hsa-miR-3922-5p	CLIP-seq
MIRT1197439	hsa-miR-3935	CLIP-seq
MIRT1197440	hsa-miR-421	CLIP-seq
MIRT1197441	hsa-miR-4263	CLIP-seq
MIRT1197442	hsa-miR-4276	CLIP-seq
MIRT1197443	hsa-miR-4539	CLIP-seq
MIRT1197444	hsa-miR-4691-5p	CLIP-seq
MIRT1197445	hsa-miR-4751	CLIP-seq
MIRT1197446	hsa-miR-4753-5p	CLIP-seq
MIRT1197447	hsa-miR-4793-5p	CLIP-seq
MIRT1197448	hsa-miR-500b	CLIP-seq
MIRT1197449	hsa-miR-502-5p	CLIP-seq
MIRT1197450	hsa-miR-580	CLIP-seq
MIRT1197451	hsa-miR-934	CLIP-seq
MIRT2057176	hsa-miR-4517	CLIP-seq
MIRT2057177	hsa-miR-582-5p	CLIP-seq
MIRT2057178	hsa-miR-630	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000298	Function	Endopolyphosphatase activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008486	Function	Diphosphoinositol-polyphosphate diphosphatase activity	IBA
GO:0008486	Function	Diphosphoinositol-polyphosphate diphosphatase activity	IEA
GO:0008486	Function	Diphosphoinositol-polyphosphate diphosphatase activity	ISS
GO:0016462	Function	Pyrophosphatase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0034431	Function	Bis(5'-adenosyl)-hexaphosphatase activity	IBA
GO:0034431	Function	Bis(5'-adenosyl)-hexaphosphatase activity	IEA
GO:0034432	Function	Bis(5'-adenosyl)-pentaphosphatase activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0071543	Process	Diphosphoinositol polyphosphate metabolic process	IBA
GO:1901907	Process	Diadenosine pentaphosphate catabolic process	IBA
GO:1901909	Process	Diadenosine hexaphosphate catabolic process	IBA
GO:1901911	Process	Adenosine 5'-(hexahydrogen pentaphosphate) catabolic process	IBA

Other IDs

• MIM: 300527
• HGNC: 17621
• e!Ensembl: ENSG00000122824

Protein

• UniProt ID: Q8NFP7
• Protein name: Diphosphoinositol polyphosphate phosphohydrolase 3-alpha (DIPP-3-alpha) (DIPP3-alpha) (hDIPP3alpha) (EC 3.6.1.52) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-alpha) (Diadenosine hexaphosphate hydrolase (AMP-forming)) (EC 3.6.1.60) (Nucleoside dip
• Protein function: Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A an
• PDB: 3MCF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00293	NUDIX	16 → 143	NUDIX domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed. {ECO:0000269|PubMed:12105228, ECO:0000269|PubMed:12121577}.
• Sequence:

  MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGG
  AAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWF
  KVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP

• Sequence length: 164

Pathways

Reactome Pathway:

Synthesis of pyrophosphates in the cytosol

Related Genes

No strongly related genes found yet for NUDT10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NUDT10.