NUDT1 (nudix hydrolase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4521
• Gene name: Nudix hydrolase 1
• Gene symbol: NUDT1
• Synonyms (NCBI Gene): MTH1
• Chromosome: 7
• Chromosome location: 7p22.3
• Summary: Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized puri

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006788	hsa-miR-145-5p	Microarray, qRT-PCR, Western blot	21289483
MIRT755424	hsa-miR-4478	Luciferase reporter assay, Western blotting, qRT-PCR	36130054

Gene ontology (GO) Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	12857738
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	7782328
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	12857738
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	7782328
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006152	Process	Purine nucleoside catabolic process	IDA	11139615
GO:0006281	Process	DNA repair	IC	10373420
GO:0006979	Process	Response to oxidative stress	TAS	8226881
GO:0008413	Function	8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity	IBA
GO:0008413	Function	8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity	IDA	10373420, 22556419
GO:0008413	Function	8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity	IEA
GO:0008828	Function	DATP diphosphatase activity	IDA	11139615
GO:0008828	Function	DATP diphosphatase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016818	Function	Hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	IDA	30304478
GO:0030515	Function	SnoRNA binding	IEA
GO:0030515	Function	SnoRNA binding	ISS
GO:0035539	Function	8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity	IDA	10608900, 11139615, 22556419
GO:0035539	Function	8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity	IEA
GO:0042262	Process	DNA protection	IBA
GO:0042262	Process	DNA protection	IDA	10608900
GO:0042262	Process	DNA protection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047693	Function	ATP diphosphatase activity	IDA	10373420
GO:0106377	Function	2-hydroxy-ATP hydrolase activity	IDA	11139615
GO:0106377	Function	2-hydroxy-ATP hydrolase activity	IEA
GO:0106378	Function	2-hydroxy-dATP hydrolase activity	IDA	11139615
GO:0106378	Function	2-hydroxy-dATP hydrolase activity	IEA
GO:0106431	Function	N6-methyl-(d)ATP hydrolase activity	IEA
GO:0106433	Function	O6-methyl-dGTP hydrolase activity	IEA
GO:0140933	Function	5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase activity	ISS

Other IDs

• MIM: 600312
• HGNC: 8048
• e!Ensembl: ENSG00000106268

Protein

• UniProt ID: P36639
• Protein name: Oxidized purine nucleoside triphosphate hydrolase (EC 3.6.1.56) (2-hydroxy-dATP diphosphatase) (7,8-dihydro-8-oxoguanine triphosphatase) (8-oxo-dGTPase) (Methylated purine nucleoside triphosphate hydrolase) (EC 3.6.1.-) (Nucleoside diphosphate-linked moie
• Protein function: Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool (PubMed:10608900, PubMed:12857738, PubMed:22556419, PubMed:24695224, PubMed:24695225, PubMed:26238318, PubMed:28679043, PubMed:77135
• PDB: 1IRY , 3Q93 , 3WHW , 3ZR0 , 3ZR1 , 4C9W , 4C9X , 4N1T , 4N1U , 5ANS , 5ANT , 5ANU , 5ANV , 5ANW , 5FSI , 5FSK , 5FSL , 5FSM , 5FSN , 5FSO , 5GHI , 5GHJ , 5GHM , 5GHN , 5GHO , 5GHP , 5GHQ , 5NGR , 5NGS , 5NGT , 5NHY , 5OTM , 5WS7 , 6AA3 , 6AA4 , 6AA5 , 6EQ2 , 6EQ3 , 6EQ4 , 6EQ5 , 6EQ6 , 6EQ7 , 6F1X , 6F20 , 6F22 , 6F23 , 6GLE , 6GLF , 6GLG , 6GLH , 6GLI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00293	NUDIX	45 → 168	NUDIX domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest expression in thymus, testis, embryo and proliferating blood lymphocytes. {ECO:0000269|PubMed:9211940}.
• Sequence:

  MYWSNQITRRLGERVQGFMSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVL
  LGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPE
  LMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKF
  QGQDTILDYTLREVDTV

• Sequence length: 197

Pathways

Reactome Pathway:

Phosphate bond hydrolysis by NUDT proteins

Related Genes

No strongly related genes found yet for NUDT1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NUDT1.