NTN3 (netrin 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4917
Gene name Netrin 3
Gene symbol NTN3
Synonyms (NCBI Gene)
NTN2L
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017587 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0005102 Function Signaling receptor binding IEA
GO:0005515 Function Protein binding IPI 26190107
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602349 8030 ENSG00000162068
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00634
Protein name Netrin-3 (Netrin-2-like protein)
Protein function Netrins control guidance of CNS commissural axons and peripheral motor axons.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00053 Laminin_EGF 374 → 421 Laminin EGF domain Domain
PF00053 Laminin_EGF 311 → 371 Laminin EGF domain Domain
PF00053 Laminin_EGF 255 → 308 Laminin EGF domain Domain
PF00055 Laminin_N 40 → 253 Laminin N-terminal (Domain VI) Family
PF01759 NTR 457 → 570 UNC-6/NTR/C345C module Domain
Tissue specificity TISSUE SPECIFICITY: Spinal cord. {ECO:0000269|PubMed:9143507}.
Sequence 
MPGWPWGLLLTAGTLFAALSPGPPAPADPCHDEGGAPRGCVPGLVNAALGREVLASSTCG
RPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV
SLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEALCFPA
PLAQPDGSGLLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRVVLTRPSTAGDPRDMEAVV
PYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRA
TARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRD
PGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAP
CVKTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAW
TRFPVAVLAVFRSGEERARRGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAG
GRGPGLIAARGSLVLPWRDAWTRRLRRLQRRERRGRCSAA
Sequence length 580
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Axon guidance

No strongly related genes found yet for NTN3.

No additional diseases found yet through genes similar to NTN3.