NTMT1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 28989
• Gene name: N-terminal Xaa-Pro-Lys N-methyltransferase 1
• Gene symbol: NTMT1
• Synonyms (NCBI Gene): AD-003, C9orf32, HOMT1A, METTL11A, NRMT, NRMT1, NTM1A
• Chromosome: 9
• Chromosome location: 9q34.11
• Summary: The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 6009

miRNA Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022881	hsa-miR-124-3p	Microarray	18668037
MIRT047648	hsa-miR-10a-5p	CLASH	23622248
MIRT722252	hsa-miR-3200-3p	HITS-CLIP	19536157
MIRT722251	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT722250	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT722249	hsa-miR-4433a-5p	HITS-CLIP	19536157
MIRT619008	hsa-miR-562	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	HITS-CLIP	23824327
MIRT619007	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619006	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619005	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT619004	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT516166	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT619003	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT619002	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT619001	hsa-miR-5096	HITS-CLIP	23824327
MIRT516163	hsa-miR-1303	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516173	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT516172	hsa-miR-29a-5p	PAR-CLIP	23446348
MIRT516171	hsa-miR-3064-5p	PAR-CLIP	23446348
MIRT516170	hsa-miR-6504-5p	PAR-CLIP	23446348
MIRT516169	hsa-miR-1254	PAR-CLIP	23446348
MIRT516168	hsa-miR-3116	PAR-CLIP	23446348
MIRT516167	hsa-miR-661	PAR-CLIP	23446348
MIRT516166	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516164	hsa-miR-3149	PAR-CLIP	23446348
MIRT516163	hsa-miR-1303	PAR-CLIP	23446348
MIRT722252	hsa-miR-3200-3p	HITS-CLIP	19536157
MIRT722251	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT722250	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT722249	hsa-miR-4433a-5p	HITS-CLIP	19536157
MIRT619008	hsa-miR-562	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	HITS-CLIP	23824327
MIRT619007	hsa-miR-3622a-3p	HITS-CLIP	23824327
MIRT619006	hsa-miR-3622b-3p	HITS-CLIP	23824327
MIRT619005	hsa-miR-6765-3p	HITS-CLIP	23824327
MIRT619004	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT516166	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT619003	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT619002	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT619001	hsa-miR-5096	HITS-CLIP	23824327
MIRT516163	hsa-miR-1303	HITS-CLIP	23824327
MIRT516174	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516173	hsa-miR-6872-3p	PAR-CLIP	23446348
MIRT516172	hsa-miR-29a-5p	PAR-CLIP	23446348
MIRT516171	hsa-miR-3064-5p	PAR-CLIP	23446348
MIRT516170	hsa-miR-6504-5p	PAR-CLIP	23446348
MIRT516169	hsa-miR-1254	PAR-CLIP	23446348
MIRT516168	hsa-miR-3116	PAR-CLIP	23446348
MIRT516167	hsa-miR-661	PAR-CLIP	23446348
MIRT516166	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT516165	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516164	hsa-miR-3149	PAR-CLIP	23446348
MIRT516163	hsa-miR-1303	PAR-CLIP	23446348

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20668449, 32296183
GO:0005634	Component	Nucleus	IDA	20668449
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0007051	Process	Spindle organization	IBA
GO:0007051	Process	Spindle organization	IMP	20668449
GO:0007059	Process	Chromosome segregation	IMP	20668449
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008276	Function	Protein methyltransferase activity	IDA	20481588, 20668449
GO:0008276	Function	Protein methyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018013	Process	N-terminal peptidyl-glycine methylation	IDA	26543159
GO:0018016	Process	N-terminal peptidyl-proline dimethylation	IDA	20481588, 20668449
GO:0032259	Process	Methylation	IEA
GO:0035572	Process	N-terminal peptidyl-serine dimethylation	IDA	20668449
GO:0035573	Process	N-terminal peptidyl-serine trimethylation	IDA	20668449
GO:0042054	Function	Histone methyltransferase activity	IDA	26543159
GO:0071885	Function	N-terminal protein N-methyltransferase activity	IBA
GO:0071885	Function	N-terminal protein N-methyltransferase activity	IDA	26543159
GO:0071885	Function	N-terminal protein N-methyltransferase activity	IEA

Other IDs

• MIM: 613560
• HGNC: 23373
• e!Ensembl: ENSG00000148335

Protein

• UniProt ID: Q9BV86
• Protein name: N-terminal Xaa-Pro-Lys N-methyltransferase 1 (EC 2.1.1.244) (Alpha N-terminal protein methyltransferase 1A) (Methyltransferase-like protein 11A) (N-terminal RCC1 methyltransferase) (X-Pro-Lys N-terminal protein methyltransferase 1A) (NTM1A) [Cleaved into:
• Protein function: Distributive alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Gly/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of the exp
• PDB: 2EX4 , 5CVD , 5CVE , 5E1B , 5E1D , 5E1M , 5E1O , 5E2A , 5E2B , 6DTN , 6KDQ , 6PVA , 6PVB , 6WH8 , 6WJ7 , 7K3D , 7SS1 , 7U1M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05891	Methyltransf_PK	8 → 223	AdoMet dependent proline di-methyltransferase	Family

• Sequence:

  MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
  GTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQ
  DFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVD
  SSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR

• Sequence length: 223

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25909287, 28556566	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25909287, 28556566	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36228414, 39379942	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28556566	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28556566	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28556566		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37901469	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for NTMT1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NTMT1.