Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	64943
Gene name	5'-nucleotidase domain containing 2
Gene symbol	NT5DC2
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3p21.1

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030270	hsa-miR-26b-5p	Microarray	19088304
MIRT052241	hsa-let-7b-5p	CLASH	23622248
MIRT051686	hsa-let-7e-5p	CLASH	23622248
MIRT051291	hsa-miR-16-5p	CLASH	23622248
MIRT046905	hsa-miR-221-3p	CLASH	23622248
MIRT042644	hsa-miR-423-3p	CLASH	23622248
MIRT042173	hsa-miR-484	CLASH	23622248
MIRT037848	hsa-miR-455-3p	CLASH	23622248
MIRT036776	hsa-miR-760	CLASH	23622248
MIRT2056814	hsa-miR-3675-5p	CLIP-seq
MIRT2056815	hsa-miR-486-3p	CLIP-seq

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0008253	Function	5'-nucleotidase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	ISS
GO:0045914	Process	Negative regulation of catecholamine metabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051354	Process	Negative regulation of oxidoreductase activity	ISS
GO:1903180	Process	Negative regulation of dopamine biosynthetic process	ISS

MIM	HGNC	e!Ensembl
621077	25717	ENSG00000168268

Q9H857

Protein name

5'-nucleotidase domain-containing protein 2 (EC 3.1.3.-)

Protein function

Promotes dephosphorylation of tyrosine 3-monooxygenase TH which decreases TH catalytic activity and leads to reduced synthesis of catecholamines including dopamine, noradrenaline and adrenaline. The exact mechanism of activity is unknown but may

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05761	5_nucleotid	56 → 497		Family

Sequence

MRVESGSAQERGILLESLSTLLEKTTASHEGRAPGNRELTDLLPPEVCSLLNPAAIYANN
EISLRDVEVYGFDYDYTLAQYADALHPEIFSTARDILIEHYKYPEGIRKYDYNPSFAIRG
LHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEVIELYGGTQHIPLYQMSGFYGKGPS
IKQFMDIFSLPEMALLSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDM
EKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMRHMVGPDWRQLFDVVIVQADK
PSFFTDRRKPFRKLDEKGSLQWDRITRLEKGKIYRQGNLFDFLRLTEWRGPRVLYFGDHL
YSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQTYQDAESR
QVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYR
VDFTFYPRRTPLQHEAPLWMDQLCTGCMKTPFLGDMAHIR

Sequence length

520

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	34127677	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	29559693	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Borderline Personality Disorder	Borderline personality disorder	Pubtator	25612291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30978441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36820551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	25612291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30978441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30978441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30978441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	39684755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	29559693		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	31279527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37800836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with NT5DC2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for NT5DC2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to NT5DC2 (see Related Genes above), that are NOT already directly curated for NT5DC2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to NT5DC2.

NT5DC2 (5'-nucleotidase domain containing 2)

Bookmark This Gene