NSUN5P2 (NSUN5 pseudogene 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 260294
Gene name NSUN5 pseudogene 2
Gene symbol NSUN5P2
Synonyms (NCBI Gene)
NOL1R2NSUN5CWBSCR20BWBSCR20C
Chromosome 7
Chromosome location 7q11.23
Summary This locus represents a transcribed pseudogene of a nearby locus on chromosome 7, which encodes a putative methyltransferase. There is also a third closely related pseudogene locus in this region. There is extensive alternative splicing at this locus. [pr
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001510 Process RNA methylation IEA
GO:0003723 Function RNA binding IEA
GO:0006396 Process RNA processing IEA
GO:0008168 Function Methyltransferase activity IEA
GO:0008173 Function RNA methyltransferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q63ZY6
Protein name Putative methyltransferase NSUN5C (EC 2.1.1.-) (NOL1/NOP2/Sun domain family member 5C) (Williams-Beuren syndrome chromosomal region 20C protein)
Protein function May have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01189 Methyltr_RsmB-F 35 → 239 16S rRNA methyltransferase RsmB/F Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11978965, ECO:0000269|PubMed:12073013}.
Sequence 
MPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPRQAPMSWMPVPPQAIKTSHL
AALLKNQGKIFAFDLDARRLASMATLLAWAGVSCCELAEEDFLAVSPLDPRYREVHYVLL
DPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQE
ENEDMVQDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIER
VEMPTSASQAKASAPERTPSPAPKRKKRAKSCSRCLHTALHIAEAPGSLLPGGKGRCLSS
PWKTLGPHRRQQFAF
Sequence length 315
Interactions View interactions

No strongly related genes found yet for NSUN5P2.

No additional diseases found yet through genes similar to NSUN5P2.