NSMCE4A (NSE4A component of SMC5/6 complex)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54780
• Gene name: NSE4A component of SMC5/6 complex
• Gene symbol: NSMCE4A
• Synonyms (NCBI Gene): C10orf86, NS4EA, NSE4A
• Chromosome: 10
• Chromosome location: 10q26.13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT032268	hsa-let-7b-5p	Proteomics	18668040
MIRT1195385	hsa-miR-4477a	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	NAS	16810316
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000781	Component	Chromosome, telomeric region	NAS	17589526
GO:0005515	Function	Protein binding	IPI	20864041, 21364888, 27427983, 28514442, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006310	Process	DNA recombination	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	18086888
GO:0016604	Component	Nuclear body	IDA
GO:0016925	Process	Protein sumoylation	NAS	32389690
GO:0030915	Component	Smc5-Smc6 complex	IBA
GO:0030915	Component	Smc5-Smc6 complex	IDA	18086888
GO:0030915	Component	Smc5-Smc6 complex	IEA
GO:0030915	Component	Smc5-Smc6 complex	NAS	32389690
GO:0032204	Process	Regulation of telomere maintenance	NAS	17589526
GO:0140588	Process	Chromatin looping	NAS	32389690

Other IDs

• MIM: 612987
• HGNC: 25935
• e!Ensembl: ENSG00000107672

Protein

• UniProt ID: Q9NXX6
• Protein name: Non-structural maintenance of chromosomes element 4 homolog A (NS4EA) (Non-SMC element 4 homolog A)
• Protein function: Component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08743	Nse4_C	285 → 376	Nse4 C-terminal	Domain
  PF15412	Nse4-Nse3_bdg	133 → 189	Binding domain of Nse4/EID3 to Nse3-MAGE	Domain

• Sequence:

  MSGDSSGRGPEGRGRGRDPHRDRTRSRSRSRSPLSPRSRRGSARERREAPERPSLEDTEP
  SDSGDEMMDPASLEAEADQGLCRQIRHQYRALINSVQQNREDILNAGDKLTEVLEEANTL
  FNEVSRAREAVLDAHFLVLASDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEE
  LIRDEDSPDFEFIVYDSWKITGRTAENTFNKTHTFHFLLGSIYGECPVPKPRVDRPRKVP
  VIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFREDPDTPMSFFDFVVDPHSFPR
  TVENIFHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQGIIALSYRDW
  EEIVKTFEISEPVITPSQRQQKPSA

• Sequence length: 385

Pathways

Reactome Pathway:

SUMOylation of DNA damage response and repair proteins

Related Genes

No strongly related genes found yet for NSMCE4A.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NSMCE4A.