NSFL1C (NSFL1 cofactor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55968
• Gene name: NSFL1 cofactor
• Gene symbol: NSFL1C
• Synonyms (NCBI Gene): P47, UBX1, UBXD10, UBXN2C, dJ776F14.1
• Chromosome: 20
• Chromosome location: 20p13
• Summary: N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a h

miRNA Show/Hide all (130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019752	hsa-miR-375	Microarray	20215506
MIRT021624	hsa-miR-142-3p	Microarray	17612493
MIRT049768	hsa-miR-92a-3p	CLASH	23622248
MIRT044711	hsa-miR-320a	CLASH	23622248
MIRT042168	hsa-miR-484	CLASH	23622248
MIRT041619	hsa-miR-146b-5p	CLASH	23622248
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	20371350
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	20371350
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	20371350
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT513017	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT529393	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT529392	hsa-miR-4643	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	22012620
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	22012620
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	22012620
MIRT529391	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT529390	hsa-miR-466	PAR-CLIP	22012620
MIRT513017	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	22012620
MIRT529389	hsa-miR-4650-5p	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	23446348
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	23446348
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	23446348
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	23446348
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	23446348
MIRT513017	hsa-miR-452-3p	PAR-CLIP	23446348
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	23446348
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	23446348
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	20371350
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	20371350
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	20371350
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT513017	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT529393	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT529392	hsa-miR-4643	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	22012620
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	22012620
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	22012620
MIRT529391	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT529390	hsa-miR-466	PAR-CLIP	22012620
MIRT513017	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	22012620
MIRT529389	hsa-miR-4650-5p	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	23446348
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	23446348
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	23446348
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	23446348
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	23446348
MIRT513017	hsa-miR-452-3p	PAR-CLIP	23446348
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	23446348
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	23446348
MIRT1195067	hsa-miR-129-5p	CLIP-seq
MIRT1195068	hsa-miR-1976	CLIP-seq
MIRT1195069	hsa-miR-2276	CLIP-seq
MIRT1195070	hsa-miR-323b-5p	CLIP-seq
MIRT1195071	hsa-miR-4709-5p	CLIP-seq
MIRT1195072	hsa-miR-542-3p	CLIP-seq
MIRT1195073	hsa-miR-659	CLIP-seq
MIRT1195074	hsa-miR-1287	CLIP-seq
MIRT1195075	hsa-miR-29a	CLIP-seq
MIRT1195076	hsa-miR-29b	CLIP-seq
MIRT1195077	hsa-miR-29c	CLIP-seq
MIRT1195078	hsa-miR-3122	CLIP-seq
MIRT1195079	hsa-miR-3135b	CLIP-seq
MIRT1195080	hsa-miR-370	CLIP-seq
MIRT1195081	hsa-miR-3913-5p	CLIP-seq
MIRT1195082	hsa-miR-4434	CLIP-seq
MIRT1195083	hsa-miR-450b-3p	CLIP-seq
MIRT1195084	hsa-miR-4516	CLIP-seq
MIRT1195085	hsa-miR-4531	CLIP-seq
MIRT1195086	hsa-miR-4713-3p	CLIP-seq
MIRT1195087	hsa-miR-570	CLIP-seq
MIRT1195088	hsa-miR-638	CLIP-seq
MIRT1195089	hsa-miR-769-3p	CLIP-seq
MIRT2465750	hsa-miR-1245b-5p	CLIP-seq
MIRT2465751	hsa-miR-150	CLIP-seq
MIRT2465752	hsa-miR-3142	CLIP-seq
MIRT2465753	hsa-miR-3183	CLIP-seq
MIRT2465754	hsa-miR-4713-5p	CLIP-seq
MIRT2465755	hsa-miR-4723-3p	CLIP-seq
MIRT2465756	hsa-miR-532-3p	CLIP-seq
MIRT2583057	hsa-miR-1912	CLIP-seq
MIRT2583058	hsa-miR-3130-5p	CLIP-seq
MIRT2583059	hsa-miR-3680	CLIP-seq
MIRT2583060	hsa-miR-4482	CLIP-seq
MIRT2583061	hsa-miR-4530	CLIP-seq
MIRT2583062	hsa-miR-922	CLIP-seq
MIRT2583057	hsa-miR-1912	CLIP-seq
MIRT2583058	hsa-miR-3130-5p	CLIP-seq
MIRT2583059	hsa-miR-3680	CLIP-seq
MIRT2583060	hsa-miR-4482	CLIP-seq
MIRT2583061	hsa-miR-4530	CLIP-seq
MIRT2583062	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SPI1	Unknown	10542290

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000132	Process	Establishment of mitotic spindle orientation	IEA
GO:0000132	Process	Establishment of mitotic spindle orientation	IGI	23649807
GO:0005515	Function	Protein binding	IPI	16169070, 16275660, 20414249, 21645854, 21900206, 22466964, 25416956, 26496610, 26712280, 29997244, 32814053, 33961781, 35271311, 37776851
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	16601695
GO:0005794	Component	Golgi apparatus	IEA
GO:0005795	Component	Golgi stack	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	16601695
GO:0007030	Process	Golgi organization	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0031468	Process	Nuclear membrane reassembly	IBA
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IEA
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IGI	23649807
GO:0061025	Process	Membrane fusion	IBA
GO:1904780	Process	Negative regulation of protein localization to centrosome	IEA
GO:1904780	Process	Negative regulation of protein localization to centrosome	IGI	23649807
GO:1990730	Component	VCP-NSFL1C complex	IEA
GO:1990730	Component	VCP-NSFL1C complex	IPI	21645854
GO:1990730	Component	VCP-NSFL1C complex	ISS

Other IDs

• MIM: 606610
• HGNC: 15912
• e!Ensembl: ENSG00000088833

Protein

• UniProt ID: Q9UNZ2
• Protein name: NSFL1 cofactor p47 (UBX domain-containing protein 2C) (p97 cofactor p47)
• Protein function: Reduces the ATPase activity of VCP (By similarity). Necessary for the fragmentation of Golgi stacks during mitosis and for VCP-mediated reassembly of Golgi stacks after mitosis (By similarity). May play a role in VCP-mediated formation of transi
• PDB: 1SS6 , 8HRZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00789	UBX	290 → 369	UBX domain	Domain
  PF08059	SEP	184 → 258	SEP domain	Domain
  PF14555	UBA_4	6 → 48		Domain

• Sequence:

  MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
  VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
  DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV
  HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
  EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI
  RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL
  LNAVIVQRLT

• Sequence length: 370

Pathways

KEGG Pathway:

Protein processing in endoplasmic reticulum

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	30837480		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23884469		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17855441	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	15527168, 2398896		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28105508		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19175688	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28105508		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30559180		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17918192, 18381585		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	29599289		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15626894		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for NSFL1C.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NSFL1C.