NPY6R (neuropeptide Y receptor Y6 (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 4888
Gene name Neuropeptide Y receptor Y6 (pseudogene)
Gene symbol NPY6R
Synonyms (NCBI Gene)
NPY1RLNPY6RPPP2Y2B
Chromosome 5
Chromosome location 5q31.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004983 Function Neuropeptide Y receptor activity IKR 8910290, 9013614
GO:0005886 Component Plasma membrane IBA
GO:0007154 Process Cell communication IEA
GO:0007165 Process Signal transduction IEA
GO:0007186 Process G protein-coupled receptor signaling pathway IKR 8910290, 9013614
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
601770 7959 ENSG00000293504
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99463
Protein name Putative neuropeptide Y receptor type 6 (NPY6-R) (NPY Y1-like receptor) (Putative pancreatic polypeptide receptor 2) (PP2)
Protein function When expressed, is unable to bind pancreatic polypeptide (PP), neuropeptide Y (NPY), or peptide YY (PYY), suggesting that either it is functionally inactive or that it may have acquired a pancreatic polypeptide-independent function. {ECO:0000269
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 52 → 285 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, skeletal muscle, gastrointestinal tissues, spleen, brain and adrenal glands. {ECO:0000269|PubMed:8910290, ECO:0000269|PubMed:8910373}.
Sequence 
MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIII
FKKQRKAQNFTSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSI
SVSIFSLVFTAVERYQLIVNPRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPF
RNLSLPTDLYTHQVACVENWPSKKDRLLFTTSLFLLQYFVPLGFILICYLKIVICLRRRN
AKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISSMSSLTGIMRC
Sequence length 290
Interactions View interactions

No strongly related genes found yet for NPY6R.

No additional diseases found yet through genes similar to NPY6R.