NPY (neuropeptide Y)

Gene

• Entrez ID: 4852
• Gene name: Neuropeptide Y
• Gene symbol: NPY
• Synonyms (NCBI Gene): PYY4
• Chromosome: 7
• Chromosome location: 7p15.3
• Summary: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neurope

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016709	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	12967770
FOS	Unknown	8036020
JUN	Unknown	8036020
SP1	Unknown	2376581

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0001878	Process	Response to yeast	IDA	18603306
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	1321422
GO:0005102	Function	Signaling receptor binding	TAS	8132547, 10698177
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	TAS	2427515
GO:0005246	Function	Calcium channel regulator activity	TAS	8132547
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8132547
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	10557353
GO:0007631	Process	Feeding behavior	IBA
GO:0007631	Process	Feeding behavior	TAS	10698177
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008343	Process	Adult feeding behavior	IEA
GO:0008343	Process	Adult feeding behavior	ISS
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0019731	Process	Antibacterial humoral response	IDA	18603306
GO:0019732	Process	Antifungal humoral response	IDA	18603306
GO:0021954	Process	Central nervous system neuron development	IEP	20846339
GO:0021987	Process	Cerebral cortex development	IEP	9067840
GO:0031175	Process	Neuron projection development	IEP	20846339
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031841	Function	Neuropeptide Y receptor binding	IBA
GO:0031841	Function	Neuropeptide Y receptor binding	IEA
GO:0032100	Process	Positive regulation of appetite	IEA
GO:0032100	Process	Positive regulation of appetite	ISS
GO:0032903	Process	Regulation of nerve growth factor production	IEA
GO:0042117	Process	Monocyte activation	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045087	Process	Innate immune response	IDA	18603306
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045964	Process	Positive regulation of dopamine metabolic process	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048572	Process	Short-day photoperiodism	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	18603306
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	18603306
GO:0060575	Process	Intestinal epithelial cell differentiation	TAS	10488139
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	18603306
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0098992	Component	Neuronal dense core vesicle	ISS
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:0099538	Process	Synaptic signaling via neuropeptide	IEA
GO:1904000	Process	Positive regulation of eating behavior	IEA
GO:1904407	Process	Positive regulation of nitric oxide metabolic process	IEA
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

Other IDs

• MIM: 162640
• HGNC: 7955
• e!Ensembl: ENSG00000122585

Protein

• UniProt ID: P01303
• Protein name: Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)]
• Protein function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
• PDB: 1QFA, 1RON, 7RTA, 7VGX, 7X9A, 7X9B, 7YOO, 8K6M, 8K6N, 8K6O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00159	Hormone_3	30 → 64	Pancreatic hormone peptide	Family

• Tissue specificity: TISSUE SPECIFICITY: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
• Sequence:

  MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
  RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

• Sequence length: 97

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ABSENCE EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLINICAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, ABSENCE, ATYPICAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, MINOR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL OBSTRUCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NPY POLYMORPHISM	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1387563		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27918953		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10526260, 20483910, 2809684, 7955545, 7989494		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	2611661		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	17948870		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	10526852		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24028428, 36635346	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	25026432		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28294153, 30911572		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30911572	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28027898		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	12094613, 12468411, 15567470, 21545413, 21593415, 28093506, 31635295		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	CTD_human_DG	16084549, 16101753, 25825358		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	Pubtator	21545413	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	12013027, 12824809, 12967770, 14757324, 15048644, 15337375, 15897713, 16611091, 16691011, 17948870, 19264362, 19340021, 19854625, 20037921, 21917383, 22328461, 22553078, 22938859, 23697793, 23994577, 24841617, 27913193, 28053027, 28575455, 28824541, 29042065, 29670288, 30024942, 30863280, 30878321, 30971438, 31089694, 31114482, 31281833, 9711903		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	18385673, 20037921, 20648632, 21917383, 22584873, 29670288, 35093384	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	11440811		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	BEFREE	12013027, 12824809, 12967770, 14757324, 15048644, 15337375, 15897713, 16611091, 16691011, 17948870, 19264362, 19340021, 19854625, 20037921, 21917383, 22328461, 22553078, 22938859, 23697793, 23994577, 24841617, 27913193, 28053027, 28575455, 28824541, 29042065, 29670288, 30024942, 30863280, 30878321, 30971438, 31089694, 31114482, 31281833, 31708112, 9711903		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	25059547	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	11440811		★☆☆☆☆ Found in Text Mining only
Appetite Disorders	Eating Disorders	BEFREE	7902088		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14747236, 19119412, 21468772, 21746772, 23122776, 24858338, 28386846, 28423914, 31605707		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	23122776, 27469060, 30604629		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	32029445	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	9731035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	11489141, 18648328		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14747236, 19119412, 21468772, 21746772, 23122776, 24858338, 28386846, 28423914, 31605707		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18054939, 19119412		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21746772, 36361795	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28489853	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	20308990, 28351412, 28489853, 30617449		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29177493		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	15090072	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29177493		★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	20064661, 8868293		★☆☆☆☆ Found in Text Mining only
Bardet-Biedl Syndrome	Bardet-Biedl Syndrome	BEFREE	24316073		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10526260, 2809684		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18648328, 29542782		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11389101, 16585197, 20332211, 23236424, 23265893, 25338544, 26472474, 27914983, 28337321, 29512753, 31506520, 31709766		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12111125, 26472474, 29512753, 35115550	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	CTD_human_DG	9731035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cap Myopathy	Cap myopathy	Pubtator	11762347	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11389101		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20676325	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29438522		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36361795	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	31876927	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	11005710	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16912140, 18043699, 23624317, 28423914, 29370406, 30633126, 31708788, 31811615		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18499283		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23021333	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	9812770		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	10852461		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	21352822		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	21352822	Associate	★☆☆☆☆ Found in Text Mining only
Central Precocious Puberty	Central Precocious Puberty	BEFREE	28610651, 29145926		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	34422139	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	CTD_human_DG	11821007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	27438796		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15201542, 19619519, 29169656		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	15201542		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29956420		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	29956420		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	35484119	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	20543711, 30633126		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29370406, 30633126		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	23459936		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	23459936	Associate	★☆☆☆☆ Found in Text Mining only
clinical depression	Mental Depression	PSYGENET_DG	1353857		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clonic Seizures	Clonic Seizures	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	23482625	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26022272		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21298349, 24289328, 24485021, 26022272, 34627187, 37755164	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	35149954	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12678499, 29850786, 9686908		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18054939, 22289186, 22308535, 24897239, 25427865, 28476516		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19119412, 22289186, 22308535, 24897239, 25427865, 28476516		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24897239	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11914038, 22289186, 22308535, 24897239, 25427865, 28476516		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	14747236		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	29425286		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30015893		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30015893	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27427400		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	33086708	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	17572454, 9729278		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12013027, 14757324, 15925699, 16611091, 16691011, 17572454, 19264362, 19782662, 19854625, 22365482, 23468908, 23697793, 23994577, 28582442, 28659833, 28824541, 29643431, 30213237, 30504424, 31082535, 31736656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	17572454, 9729278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20648632, 25059547	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22365482, 23468908, 23697793, 25267070, 25635612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	17572454, 9729278		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18211417		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12570784, 12588889, 18043699, 19129396, 23315994, 27465830, 27623943, 28423914, 28614797, 28940946, 29351428, 8871182		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12570784, 12588889, 18043699, 19129396, 23315994, 27465830, 27623943, 27836326, 28423914, 28614797, 28940946, 29351428, 8871182		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21549702	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22029806, 22808091, 27749914, 7538256	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35627254	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21549702	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21746772, 22808091, 27749914, 34589546	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17984244, 20855609, 29442423, 30531682		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10852461, 10926322, 15926114, 16705546, 17268419, 17325259, 17516289, 20691708, 21549702, 21746772, 22808091, 27749914, 28468933, 29260593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	14747236		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17984244		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	LHGDN	17984244		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	21549702	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	27836326		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	10926322, 16705546		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27840126		★☆☆☆☆ Found in Text Mining only
dopamine beta hydroxylase deficiency	Dopamine Beta Hydroxylase Deficiency	BEFREE	29297566		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	12220433, 23074243		★☆☆☆☆ Found in Text Mining only
Dystonia 3, Torsion, X-Linked	Dystonia	BEFREE	23599389		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	21047193, 30569105		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	17572454, 9729278		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	11466452, 17196301, 20231455, 23994577, 27522536, 29042065, 29367144, 29414380, 29679911, 30146352, 30262417, 30367522		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	20064661, 8868293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	29367144	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	30171525	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	11466452, 26134645	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	29367144, 31852985	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsy, Benign Psychomotor, Childhood	Epilepsy	CTD_human_DG	15716408		★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	20064661, 8868293		★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	29414380		★☆☆☆☆ Found in Text Mining only
Epilepsy, Lateral Temporal	Epilepsy	CTD_human_DG	15716408		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	11287369, 11466452, 15337376, 29367144, 30262417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy, Temporal Lobe	Epilepsy	CTD_human_DG	15716408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15364898, 31659606, 7902088		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	24318733, 25387699		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	18055304		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	30911572		★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	7682155		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	27898588		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18648328		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29542782		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	31494821		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	29682090	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	31811615		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	12678499, 29850786, 9686908		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31876927	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	27889920		★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	Pubtator	19234067	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	16383010		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	23167744, 24121255, 29309751, 8735228		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	BEFREE	18031993, 19846279, 9920351		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	19846279	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	11334428, 27788523		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	11113606, 11334428, 29260593		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19309436, 22966009, 23021333	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	11689216, 15364898, 17268419, 20033074, 24779394, 28849020, 29310113, 30894678, 31659606		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	16382999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	28097455		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29779845, 30080180, 30080182, 30996341		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35093384	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35484119	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	28460516		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	10363627		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31369588		★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	34422139	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	27898588, 28460516		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17702963, 19619519, 19913525, 20435026		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37460969	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	16705546		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29370406		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	20543711, 29121414, 30633126		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	20543711		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1387563		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1387563		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	30826125, 31114482		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	28101970		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31263154		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31263154		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29996703		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15894681		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15894681		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15894681		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	26220979		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	14757324, 19264362, 20351714, 21300944, 22365482, 23468908, 28659833, 31583809		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20351714, 21300944, 21912391, 22365482, 23468908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	11389101, 16585197, 20332211, 23236424, 23265893, 25338544, 26472474, 27914983, 29512753, 31709766		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29438522		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24201779, 29433879		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16614113, 18257117, 23390522, 30191621, 30504424		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10526260, 11389101, 12094613, 21439311, 25081719, 25387699, 2809684, 28712386, 29670288, 30948035, 8871182		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28321032		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23580127, 27914983		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	17572454, 9729278		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12094613, 27427400		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	2611661		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	12013027, 14757324, 15925699, 16611091, 16691011, 17572454, 19264362, 19782662, 19854625, 22365482, 23468908, 23697793, 23994577, 28582442, 28659833, 28824541, 29643431, 30213237, 30504424, 31082535, 31736656		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22365482, 23468908, 23697793, 25267070, 25635612		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	23468908, 28073591, 28460516, 30213237, 30513310		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	18499283, 26681068, 28468933, 28580287, 29310113		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24897239, 25081719	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20881319, 22308535, 23624317, 24897239, 25081719, 27788523, 28468933		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	28476516		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	29260593		★☆☆☆☆ Found in Text Mining only
Mild depression	Mental Depression	BEFREE	22365482		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	16611091, 19854625, 23994577		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11377922, 16611091, 19782662, 23482625, 28824541, 2894462, 30337638, 30394136		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	16691011, 17572454, 19782662, 19846047, 23482625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	23482625	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	BEFREE	22365482		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	17470513		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	17470513		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27559040		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33219204	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1387563		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15201542, 29380285, 31708788		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15201542		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	39616326	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15567470, 15704095, 17470513, 19890892, 20676138, 23236424, 2393870, 25132261, 25387699, 27251038, 27743558, 27856419, 29605591, 30191621, 30640136, 30670491, 9802408		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	11489141		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15704095		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10080936, 10854907, 11004664, 20676138, 21816512, 2393870, 23994577, 25026432, 25132261, 27743558, 29367144, 29650257, 7968366, 8036020, 8123590, 8643076, 9228417, 9666082, 9802408, 9802424		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10901366, 16443729	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30911572, 36429093	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23599389, 26620558, 29309751, 29650257		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	12094613, 2384178		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17470513		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	19340021		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28547758		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	19566775		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10207720, 10832764, 11060746, 11334428, 11600552, 12220433, 12570784, 12678499, 14623356, 15894681, 16568137, 16957407, 17785427, 17979776, 18043699, 19129396, 20531438, 20881319, 21211526, 21439311, 21545413, 21799827, 21937627, 22308535, 23074243, 23122776, 23277265, 23315994, 23624317, 23652383, 23838112, 23994577, 26156739, 26240981, 26681068, 27010740, 27469060, 27623943, 27788523, 27823858, 28321032, 28345900, 28468933, 28628036, 28857123, 28864114, 28914170, 28954935, 29310113, 29370406, 29763369, 30105036, 30106124, 30628058, 30678628, 31031093, 31533726, 7902088, 8871182, 9222646, 9623983		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	10832764, 18562618, 21545413, 21937627, 23392873, 23652383, 24058506, 26156739, 28954935, 38387703	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	21799827, 9222646		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	31133798		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	18648328		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27998395, 30633834		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27998395		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	29807224, 31759680		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25387699, 27987181		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24201779, 29433879		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24201779, 40170581	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	40170581	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	10715359	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	17948870		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12591154, 21816512, 28659833, 30866091		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	19010457, 25256105, 28914594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21468772		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	17686523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	29177493		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10526260, 20483910, 2809684, 7955545, 7989494		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	7593641	Stimulate	★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	26683132		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	29934855		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21827375	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	LHGDN	16383009		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	20881319, 22801411, 27898588, 27913193, 28053027, 29169656, 29186416, 30502374, 30804766, 31082535, 31250475, 31291230, 31583809, 31622603, 31708112		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	11836343		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	17140570		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	11709213		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	11489141		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	30531682		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16614113, 18257117, 23390522, 30191621, 30504424		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	16614113		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	36583743	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11240828, 18257117, 18752015, 31164324, 33780364, 36774376, 38179769	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16339211, 17695723, 18257117		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36583743	Stimulate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	18992145	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	19566775		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	LHGDN	18420205		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31569168		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15704095		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	10926322, 12427234		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	31144161		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	CTD_human_DG	12746121		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	35484119	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	19804960		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	19804960		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	12875921, 15814194, 16390370, 17066479, 17366345, 17471287, 19121517, 19150389, 19804960, 20096928, 20125089, 23277265, 24636039, 27837667, 28073591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12875921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19804960, 24636039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	8898322		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	26134645	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures Febrile	Seizures	Pubtator	18055304	Associate	★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	25256105		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	21917383		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	21508507	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	21508507		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15567470		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25612142, 29682090	Associate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30859228, 31834357		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	30859228		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26068646, 32174791	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27438796, 30213237		★☆☆☆☆ Found in Text Mining only
Subcortical Infarction	Brain Infarction	CTD_human_DG	11821007		★☆☆☆☆ Found in Text Mining only
Substance Withdrawal Syndrome	Substance abuse	Pubtator	18828811	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tonic - clonic seizures	Seizure	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	9802408		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	31852985	Inhibit	★☆☆☆☆ Found in Text Mining only
Uncinate Epilepsy	Epilepsy	CTD_human_DG	15716408		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	14757324, 16390370, 19264362, 22365482, 23468908, 28659833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	CTD_human_DG	17572454, 9729278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20351714, 21300944, 21912391, 22365482, 23468908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29739919	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	12460920, 27923637		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	39616326	Associate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	15451008, 16194568, 18005069		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	25221996		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	25221996	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	25221996		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	17470513		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	18648328		★☆☆☆☆ Found in Text Mining only