NPS (neuropeptide S)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 594857
• Gene name: Neuropeptide S
• Gene symbol: NPS
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q26.2

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008542	Process	Visual learning	IEA
GO:0010841	Process	Positive regulation of circadian sleep/wake cycle, wakefulness	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IBA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0045202	Component	Synapse	IEA
GO:0045760	Process	Positive regulation of action potential	IBA
GO:0045760	Process	Positive regulation of action potential	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA

Other IDs

• MIM: 609513
• HGNC: 33940
• e!Ensembl: ENSG00000214285

Protein

• UniProt ID: P0C0P6
• Protein name: Neuropeptide S
• Protein function: Modulates arousal and anxiety. May play an important anorexigenic role (By similarity). Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations (PubMed:15312648, PubMed:16790440). {ECO:0000250, ECO:00
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14993	Neuropeptide_S	24 → 88	Neuropeptide S precursor protein	Family

• Sequence:

  MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKP
  ILEKMFVKRSFRNGVGTGMKKTSFQRAKS

• Sequence length: 89

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Peptide ligand-binding receptors
	G alpha (q) signalling events
	G alpha (s) signalling events
	ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (13)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	17362836	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	19339610, 21466221	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASE	—	GWAS catalog	37479695	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	19339610	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914, 36658263	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	29077507	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (61)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anxiety	Anxiety Disorder	BEFREE	20603625, 20705147, 22278093, 22399050, 22553078, 23103692, 23319044, 23325374, 23466585, 25091462, 26235955, 26503268, 28548278, 28655610, 28941995, 29118105, 30112573, 30914309, 31326375		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	22216302, 24331455, 24386135, 33332443	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	19339610, 21466221		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	BEFREE	20603625, 20705147, 21525857, 22278093, 22399050, 22553078, 23103692, 23319044, 23325374, 23466585, 25091462, 25971599, 26235955, 26503268, 28548278, 28655610, 28941995, 29118105, 30112573, 30190127, 30914309, 31326375		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	21525857, 25971599	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	19339610, 21466221		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16790440, 16926187, 20705147, 28463995		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	16790440, 16926187		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16790440, 24386135, 28463995	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal dominant hypocalcemia	Hypocalcemia	BEFREE	26052899		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28600360		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28258849		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	28463995		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	15781990		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	15781990		★☆☆☆☆ Found in Text Mining only
clinical depression	Mental Depression	BEFREE	29488437		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	24964000		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	31293402		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	27362291		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31645191		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	20171785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	27583567, 29488437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	28646701		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28646701		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30262176		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	38287231	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19732772	Associate	★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	31075445		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	8053700		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	24386135	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	22730443		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31293402		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24386135	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26206857		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	19614867		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	22158028	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	26560070		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28600360		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30226842		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	20171785		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	27583567, 29488437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	26680586		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30276884		★☆☆☆☆ Found in Text Mining only
Nail-Patella Syndrome	Nail-Patella Syndrome	BEFREE	9590288		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28887836, 30053487		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	27362291		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33332443	Associate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	23680103		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	19523478, 20628342, 20705147, 23680103, 24331455, 24964000, 25311787, 25788677, 25842293, 26235955		★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	15781990		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	30825442		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 1	Polycystic kidney disease	BEFREE	29632324		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	22278093, 29157796		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31645191		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22078257, 23680103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22078257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22078257	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seborrheic keratosis	Seborrheic keratosis	BEFREE	31809349		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	20405330		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	20405330		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	29559896		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

FOXI2 3 shared diseasesCarotid artery disease, Obstructive sleep apnea syndrome, Ocular hypotension 3 shared evidence sourcesGWAS catalog (Carotid artery disease), GWAS catalog (Obstructive sleep apnea syndrome), GWAS catalog (Ocular hypotension) Related via 3 shared diseases including Carotid artery disease, Obstructive sleep apnea syndrome — evidence mostly GWAS catalog. NPSR1 4 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production Related via 4 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events. PACRG 2 shared diseasesObstructive sleep apnea syndrome, Ocular hypotension 2 shared evidence sourcesGWAS catalog (Obstructive sleep apnea syndrome), GWAS catalog (Ocular hypotension) Related via 2 shared diseases including Obstructive sleep apnea syndrome, Ocular hypotension — evidence mostly GWAS catalog. CRHR1 2 shared diseasesAnxiety disorder, Hyperkinesia 2 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production 4 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), Disgenet (Hyperkinesia), CTD (Hyperkinesia) Related via 2 shared diseases including Anxiety disorder, Hyperkinesia — evidence mostly Disgenet. NTS 1 shared diseaseHyperkinesia 2 shared pathwaysPeptide ligand-binding receptors, G alpha (q) signalling events 2 shared evidence sourcesDisgenet (Hyperkinesia), CTD (Hyperkinesia) Related via 2 shared pathways including Peptide ligand-binding receptors, G alpha (q) signalling events — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FOXI2	3	["Carotid artery disease","Obstructive sleep apnea syndrome","Ocular hypotension"]	0	[]	3	["GWAS catalog (Carotid artery disease)","GWAS catalog (Obstructive sleep apnea syndrome)","GWAS catalog (Ocular hypotension)"]
NPSR1	0	[]	4	["Peptide ligand-binding receptors","G alpha (q) signalling events","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production"]	0	[]
PACRG	2	["Obstructive sleep apnea syndrome","Ocular hypotension"]	0	[]	2	["GWAS catalog (Obstructive sleep apnea syndrome)","GWAS catalog (Ocular hypotension)"]
CRHR1	2	["Anxiety disorder","Hyperkinesia"]	2	["G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production"]	4	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","Disgenet (Hyperkinesia)","CTD (Hyperkinesia)"]
NTS	1	["Hyperkinesia"]	2	["Peptide ligand-binding receptors","G alpha (q) signalling events"]	2	["Disgenet (Hyperkinesia)","CTD (Hyperkinesia)"]

Diseases Linked via Similar Genes

Asthma Linked via 2 of 5 related genesNPSR1, CRHR1 Ovarian cancer Linked via 2 of 5 related genesPACRG, CRHR1 Post-traumatic stress disorder Linked via 2 of 5 related genesPACRG, CRHR1 Mood disorder Linked via 2 of 5 related genesCRHR1, NTS Dental caries Linked via 1 of 5 related genesFOXI2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Asthma	2	["NPSR1","CRHR1"]
Ovarian cancer	2	["PACRG","CRHR1"]
Post-traumatic stress disorder	2	["PACRG","CRHR1"]
Mood disorder	2	["CRHR1","NTS"]
Dental caries	1	["FOXI2"]