NPIPB13 (nuclear pore complex interacting protein family, member B13)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 613037 |
| Gene name | Nuclear pore complex interacting protein family, member B13 |
| Gene symbol | NPIPB13 |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 16 |
| Chromosome location | 16p11.2 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
||||||||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A6NJU9 | |||||||||||||||
| Protein name | Nuclear pore complex-interacting protein family member B13 | |||||||||||||||
| Family and domains |
Pfam
|
|||||||||||||||
| Sequence |
MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPW |
|||||||||||||||
| Sequence length | 1138 | |||||||||||||||
| Interactions | View interactions | |||||||||||||||
|
Related Genes
Genes most often co-reported with NPIPB13 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to NPIPB13 (see Related Genes above), that are NOT already directly curated for NPIPB13 itself -- a lead worth checking, not a confirmed association.
0
|
|