Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10811
Gene name	NADPH oxidase activator 1
Gene symbol	NOXA1
Synonyms (NCBI Gene)	NY-CO-31SDCCAG31p51NOX
Chromosome	9
Chromosome location	9q34.3
Summary	This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction be

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16329988, 16636067, 17126813, 19755710, 20609497, 23957209, 25416956, 31515488, 32296183, 35031518
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	IMP	20609497
GO:0010310	Process	Regulation of hydrogen peroxide metabolic process	IMP	16636067
GO:0016020	Component	Membrane	IEA
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	IBA
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	IDA	20609497
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	IEA
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	IMP	16636067
GO:0017124	Function	SH3 domain binding	IPI	19755710
GO:0019899	Function	Enzyme binding	IPI	16636067
GO:0031267	Function	Small GTPase binding	IPI	16636067
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043020	Component	NADPH oxidase complex	IDA	16636067
GO:0043020	Component	NADPH oxidase complex	IEA
GO:0060263	Process	Regulation of respiratory burst	IMP	16636067

MIM	HGNC	e!Ensembl
611255	10668	ENSG00000188747

Q86UR1

Protein name

NADPH oxidase activator 1 (NOX activator 1) (Antigen NY-CO-31) (NCF2-like protein) (P67phox-like factor) (p51-nox)

Protein function

Functions as an activator of NOX1, a superoxide-producing NADPH oxidase. Functions in the production of reactive oxygen species (ROS) which participate in a variety of biological processes including host defense, hormone biosynthesis, oxygen sen

PDB

7CFZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	405 → 450	SH3 domain	Domain
PF00564	PB1	315 → 395	PB1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Detected in pancreas, liver, kidney, spleen, prostate, small intestine and colon. {ECO:0000269|PubMed:12716910}.

Sequence

MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRA
FDQAVTKDTCMAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQ
AWEVLHNVASAQCQLGLWTEAASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPR
GEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSP
RAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA
GAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQLGQLSYLAPG
EDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGF
RQGDTVDVLCEVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP

Sequence length

476

Interactions

View interactions

Reactome Pathway
RHO GTPases Activate NADPH Oxidases
WNT5:FZD7-mediated leishmania damping

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (8)
Adenocarcinoma	Adenocarcinoma	BEFREE	18037128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20083677, 30576919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20083677, 30576919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23551967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	25137373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20943948, 40084254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19431059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20083677		★★★★★ ★☆☆☆☆ Found in Text Mining only

NOXA1 (NADPH oxidase activator 1)

Bookmark This Gene