NOX4 (NADPH oxidase 4)

Gene

• Entrez ID: 50507
• Gene name: NADPH oxidase 4
• Gene symbol: NOX4
• Synonyms (NCBI Gene): KOX, KOX-1, RENOX
• Chromosome: 11
• Chromosome location: 11q14.3
• Summary: This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019477	hsa-miR-148b-3p	Microarray	17612493
MIRT437922	rno-miR-25-3p	Luciferase reporter assay	23722270
MIRT437922	rno-miR-25-3p	Luciferase reporter assay	23722270
MIRT756008	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26986073
MIRT734718	hsa-miR-214-3p	Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32051833
MIRT755591	hsa-miR-182-5p	Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence, ELISA	37737899
MIRT756008	hsa-miR-99a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35135443
MIRT1190255	hsa-miR-34b	CLIP-seq
MIRT1190256	hsa-miR-34c-3p	CLIP-seq
MIRT1190257	hsa-miR-3545-3p	CLIP-seq
MIRT1190258	hsa-miR-4256	CLIP-seq
MIRT1190259	hsa-miR-4635	CLIP-seq
MIRT1190260	hsa-miR-4680-5p	CLIP-seq
MIRT1190261	hsa-miR-4714-5p	CLIP-seq
MIRT1190262	hsa-miR-548g	CLIP-seq
MIRT1190263	hsa-miR-640	CLIP-seq
MIRT1190257	hsa-miR-3545-3p	CLIP-seq
MIRT1190264	hsa-miR-3663-5p	CLIP-seq
MIRT1190258	hsa-miR-4256	CLIP-seq
MIRT1190265	hsa-miR-4273	CLIP-seq
MIRT1190266	hsa-miR-4303	CLIP-seq
MIRT1190267	hsa-miR-4517	CLIP-seq
MIRT1190259	hsa-miR-4635	CLIP-seq
MIRT1190268	hsa-miR-4677-5p	CLIP-seq
MIRT1190260	hsa-miR-4680-5p	CLIP-seq
MIRT1190261	hsa-miR-4714-5p	CLIP-seq
MIRT1190263	hsa-miR-640	CLIP-seq
MIRT1190269	hsa-miR-1271	CLIP-seq
MIRT1190270	hsa-miR-182	CLIP-seq
MIRT1190271	hsa-miR-3622a-5p	CLIP-seq
MIRT1190272	hsa-miR-375	CLIP-seq
MIRT1190273	hsa-miR-4258	CLIP-seq
MIRT1190274	hsa-miR-4423-3p	CLIP-seq
MIRT1190275	hsa-miR-4428	CLIP-seq
MIRT1190276	hsa-miR-4642	CLIP-seq
MIRT1190277	hsa-miR-4775	CLIP-seq
MIRT1190278	hsa-miR-498	CLIP-seq
MIRT1190279	hsa-miR-590-3p	CLIP-seq
MIRT1190280	hsa-miR-9	CLIP-seq
MIRT1190281	hsa-miR-96	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1190275	hsa-miR-4428	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT2055110	hsa-miR-1237	CLIP-seq
MIRT2055111	hsa-miR-1248	CLIP-seq
MIRT2055112	hsa-miR-1303	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT2055113	hsa-miR-370	CLIP-seq
MIRT2055114	hsa-miR-3977	CLIP-seq
MIRT1190273	hsa-miR-4258	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT2284061	hsa-miR-935	CLIP-seq
MIRT2055110	hsa-miR-1237	CLIP-seq
MIRT2055111	hsa-miR-1248	CLIP-seq
MIRT2055112	hsa-miR-1303	CLIP-seq
MIRT2055113	hsa-miR-370	CLIP-seq
MIRT2055114	hsa-miR-3977	CLIP-seq
MIRT2439047	hsa-miR-129-5p	CLIP-seq
MIRT2439047	hsa-miR-129-5p	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	18554521
NFKB1	Activation	20622120
RELA	Activation	20622120
SP3	Activation	21235713
STAT1	Unknown	19834108
STAT3	Unknown	19834108
STAT4	Unknown	19834108

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	10869423
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000902	Process	Cell morphogenesis	ISS	10869423
GO:0003015	Process	Heart process	IEA
GO:0003015	Process	Heart process	IGI	27525436
GO:0005515	Function	Protein binding	IPI	15356101, 17064675
GO:0005634	Component	Nucleus	IDA	16324151, 23393389
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	27525436
GO:0005730	Component	Nucleolus	IDA	23393389
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS	27525436
GO:0005783	Component	Endoplasmic reticulum	IDA	21343298
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15927447
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16019190, 21343298
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IEA
GO:0006801	Process	Superoxide metabolic process	IDA	18760347
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006952	Process	Defense response	IBA
GO:0006954	Process	Inflammatory response	TAS	10869423
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS	10869423
GO:0009055	Function	Electron transfer activity	TAS	10869423
GO:0010467	Process	Gene expression	IMP	23144758
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10869423
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IBA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IDA	14966267, 15356101, 15927447, 25062272
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IMP	21343298
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	TAS	10869423
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	15721269
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	10869423, 11032835, 15155719, 15721269, 15927447, 16019190, 16179589, 16230378, 16324151, 23393389, 25062272
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019826	Function	Oxygen sensor activity	TAS	10869423
GO:0020037	Function	Heme binding	IDA	25062272
GO:0020037	Function	Heme binding	TAS	10869423
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS	27525436
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0042554	Process	Superoxide anion generation	ISS	10869423
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0045453	Process	Bone resorption	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15721269
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	27525436
GO:0050660	Function	Flavin adenine dinucleotide binding	TAS	10869423
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0072341	Function	Modified amino acid binding	IDA	20031578
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097038	Component	Perinuclear endoplasmic reticulum	ISS	27525436
GO:0106292	Function	Superoxide-generating NADPH oxidase activity	IEA
GO:1903409	Process	Reactive oxygen species biosynthetic process	NAS	27525436
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	ISS	27525436
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

Other IDs

• MIM: 605261
• HGNC: 7891
• e!Ensembl: ENSG00000086991

Protein

• UniProt ID: Q9NPH5
• Protein name: NADPH oxidase 4 (EC 1.6.3.1) (Kidney oxidase-1) (KOX-1) (Kidney superoxide-producing NADPH oxidase) (Renal NAD(P)H-oxidase)
• Protein function: NADPH oxidase that catalyzes predominantly the reduction of oxygen to H2O2 (PubMed:14966267, PubMed:15356101, PubMed:15927447, PubMed:21343298, PubMed:25062272). Can also catalyze to a smaller extent, the reduction of oxygen to superoxide (PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01794	Ferric_reduct	58 → 205	Ferric reductase like transmembrane component	Family
  PF08022	FAD_binding_8	306 → 417	FAD-binding domain	Domain
  PF08030	NAD_binding_6	423 → 561	Ferric reductase NAD binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, br
• Sequence:

  MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
  ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
  AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
  AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
  EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
  RYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
  TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
  LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
  NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
  TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS

• Sequence length: 578

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	30817088		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30813866		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	21656576		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26986073		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	25252997	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	27634671		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19671250		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30615595		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28232723, 29039574		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29471108		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	27634835, 27912196, 28751569		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11914250, 25950600, 26169727, 26715682, 26812119, 27146088, 27986445, 28185955, 29047077, 29931336, 30816428, 31292433		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32414400, 37174663	Associate	★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	31434799		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17369289, 26656251		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17369289		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17369289	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22108207	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	18508317		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11914250, 25950600, 26169727, 26715682, 26812119, 27146088, 27986445, 28185955, 29047077, 29931336, 30816428, 31292433		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15572675, 19526729, 20360249	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28011270, 31419440		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	22618020		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29399101, 29467841		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	31352786		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15638999		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20523116, 30149757, 31119045		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40634441	Stimulate	★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	26457758		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	30058122		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21915726, 28422720, 37392558, 40634441	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25818486		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27282266, 27941881, 28894215, 29237157, 36964576, 37463530	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28081539		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21118808	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16230378, 22303451, 32356935, 32492552	Associate	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	30813866		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	30813866	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35090586	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	31049135		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30372866		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18849343, 24450852, 25950600, 26054376, 28230797, 29047077, 29931336, 30334629		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27075483, 27910195, 28634073		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24206089, 27075483, 29849881		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	31827696		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26822084, 28396118, 28820443, 31247506		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29986678		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26222337		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	16230378		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29155324, 30525222		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21656576, 25096929		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	20715105		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	33140821	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28422720		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21656576, 25096929, 28422720, 32641980	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16179589, 29204124, 29288409, 29931336, 30450923, 31196626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	20304815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16230378, 24755467		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11914250, 30681251		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30681251		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30681251		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28337255		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	31167233		★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	29069580		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26521743, 30012342, 31539804		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30423565		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30736297		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	27576129		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20861022, 24511132, 25866826, 27455510, 28105508, 28160092, 28587189, 29931336, 30196019, 30456880, 30813866, 31661292, 31759066		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20861022, 24511132, 25866826, 26715682, 27455510, 28105508, 28160092, 28587189, 29931336, 30196019, 30456880, 30813866, 31661292, 31759066		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30813866	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30178632	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	20861022, 29147462		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30178632, 30188871, 30265686, 30681251, 31105821		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30178632		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	25014566		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	19415232	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	19415232, 23991195, 24511132, 25415612, 28165467, 28395989, 28487945, 29106395, 29328400, 29367111, 29793963, 29854821, 29931336, 30245133, 30746698, 31465542		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28682956		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23144758, 30178632, 36506045	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30178632, 30431086, 31618425		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	GWASCAT_DG	30178632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	BEFREE	30681251		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32641980	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30813866		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30813866	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39672281	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28578276	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	25888330, 30087027		★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	29398271		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22618020, 23049784, 25888330, 26222337, 30036633, 30543783, 31154269, 31750301		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	25311168		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	29852040, 31847785	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	30058122		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18398429, 18508317, 22713363, 24868315, 26297045		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24868315, 35203105	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18398429, 22713363, 24868315, 26297045		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18508317		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18508317		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24868315	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	25252997	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	31626946		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	31466336, 31671815		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35008579	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35008579	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28578276	Stimulate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	34847940	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Defects Congenital	Congenital heart defect	Pubtator	35035663	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16179589, 29204124, 29288409, 29931336, 30450923, 31196626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	18387435, 26449263	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	20304815		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	20304815		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31279900		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31106596	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	26169727		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	21525431, 22572850, 23612968, 29654303, 30046379, 30359759, 30681251, 31465542		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	22572850	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28840773	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	25888330		★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	29986678	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17585072, 20622120, 26558820, 28035366, 28078487, 29113787, 29844144, 29986678, 30551445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	17585072, 18593227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	27659729, 27847271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	17369289, 36840500	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19036873, 22303451, 29237157	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24520084, 25557278, 29426376, 33499904, 35377824, 40222298	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27402919, 28431936, 29047077, 30840299, 31023188, 31165592, 31239370		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19701206, 20685750, 26315535, 27576730, 28389561		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	20685750, 31119153	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33325804	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	17585072, 18593227		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28314381		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	28314381	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21798347, 29113796, 30736297		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36899420	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	29147462		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31025242		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	29204124		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29087944		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	30106111		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	31117291		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29106395, 29969717		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	CTD_human_DG	23325087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	22496405, 29106395, 29329317, 29329393, 29908908, 29931336, 31318905, 31768706		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19420110		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	24511132, 28408246, 31247506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	16230378	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	31821410		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	20304815		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	24520084	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35377824	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16754784		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26308771		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18845355, 21915726, 24509161, 25961022, 27941881, 31443922		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26222337, 31443922		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	28855398, 35035671	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24509161		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19036873, 28855398	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28081539	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	31312363		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	26238284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20523116, 30149757, 31119045		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30813866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24509161		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28081539		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24123012, 24583638, 30058122		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29441570, 30637800		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29118906, 29496628, 29872318, 30237423, 31312363		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27401113		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18398429, 19779036, 24583638, 24946933, 25950600, 27401113, 27989748, 28138033, 28422720, 28578276, 28723216, 28922779, 29051480, 30281903, 30513726, 30523245, 31172474, 31443922, 31661292		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20715105, 21656576, 25096929		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	20715105		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29491408, 30887279		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20523116		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29471108		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11997235, 19276355, 24780245, 24911159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	11997235, 24911159, 33451139	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	28578276	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	28809856		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27455510		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	25888935	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25888935, 29113787, 30087027		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36915111	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31345363		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	29850876	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	35090586	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	24719867	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	20304815		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24450852, 29800789, 30663266, 31318113		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	30055798		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19671250, 22846744		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29424902		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29424902	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18398429, 18508317, 19779036, 21656576, 21915726, 22713363, 24123012, 24509161, 24583638, 24780245, 24868315, 24911159, 24946933, 27941881, 28196727, 28578276, 28620580, 29441570, 29496628, 30058122, 30281903, 30769285, 31178956, 31312363		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30820023		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31117291		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28620580, 29426376, 29671417		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	29426376	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25645462, 37081190	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30087027		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24946933, 25504436, 27989748, 28196727, 30431083, 30769285		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28062496, 30813866, 31563085, 31800011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	30813866	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	23840483, 32516132	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26521743	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	40289338	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	26722597, 28611356		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28578276, 34209278	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24123012, 24583638, 29039574, 30058122		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28232723, 29039574		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15155719, 16532036, 17983808		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15155719, 21118808	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33499904	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27401113		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25645462	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30736297		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	25866826		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31552548		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30736297		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	25866826		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29441570, 30637800		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26473288, 36891298	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29441570	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24835767, 28431936, 29047077, 31165592		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27435477, 29986678	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23977848, 26315535, 27576730, 28336812, 28476015, 28613983, 28751023, 28855398, 29652517, 31075733, 31172491, 31434799		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33325804	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29106395		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16230378, 24755467, 29106395		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28805491, 31465542, 31844679		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	CTD_human_DG	23325087		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	30369309		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28062482		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25866826, 28587189		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	38118351	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17122966, 30897288		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	24947524		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31119153, 37246768	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29794432		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	31011401		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30571282		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24048704	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21482679, 24048704		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	30513726		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30983975		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25888330		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29118906, 29496628, 29872318, 30237423, 31312363		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34983559, 35023280, 35938505	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28330417		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30226391, 30470772		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	31065679		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19779036, 27401113, 30367082		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20407074		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27401113		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30367082	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	29491408		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	28578276	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21252614, 22032647	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	31059037		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24385682	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29360265, 29982434, 30226391		★☆☆☆☆ Found in Text Mining only