NOTCH2NLB (notch 2 N-terminal like B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100996763
Gene name Notch 2 N-terminal like B
Gene symbol NOTCH2NLB
Synonyms (NCBI Gene)
N2NNOTCH2NLNOTCH2NLA
Chromosome 1
Chromosome location 1q21.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005112 Function Notch binding IBA
GO:0005112 Function Notch binding IPI 29856954
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 29856955
GO:0005576 Component Extracellular region IDA 29856954, 29856955
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618024 53923 ENSG00000286019
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DPK3
Protein name Notch homolog 2 N-terminal-like protein B
Protein function Human-specific protein that promotes neural progenitor proliferation and evolutionary expansion of the brain neocortex by regulating the Notch signaling pathway (PubMed:29561261, PubMed:29856954, PubMed:29856955). Able to promote neural progenit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00008 EGF 109 → 141 EGF-like domain Domain
PF00008 EGF 68 → 100 EGF-like domain Domain
PF00008 EGF 148 → 178 EGF-like domain Domain
PF07645 EGF_CA 182 → 225 Calcium-binding EGF domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in radial glia neural stem cells during cortical development. {ECO:0000269|PubMed:29856954}.
Sequence 
MPALRPALLWALLALWLCCATPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
Sequence length 275
Interactions View interactions

No strongly related genes found yet for NOTCH2NLB.

No additional diseases found yet through genes similar to NOTCH2NLB.