NOTCH2NLA (notch 2 N-terminal like A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 388677
Gene name Notch 2 N-terminal like A
Gene symbol NOTCH2NLA
Synonyms (NCBI Gene)
N2NNOTCH2NL
Chromosome 1
Chromosome location 1q21.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005112 Function Notch binding IPI 29856954
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 24722188, 25416956, 25910212, 26871637, 29892012, 31515488
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618023 31862 ENSG00000264343
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z3S9
Protein name Notch homolog 2 N-terminal-like protein A (Notch homolog 2 N-terminal-like protein)
Protein function Human-specific protein that promotes neural progenitor proliferation and evolutionary expansion of the brain neocortex by regulating the Notch signaling pathway (PubMed:29561261, PubMed:29856954, PubMed:29856955). Able to promote neural progenit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00008 EGF 69 → 102 EGF-like domain Domain
PF00008 EGF 29 → 61 EGF-like domain Domain
PF00008 EGF 109 → 139 EGF-like domain Domain
PF07645 EGF_CA 143 → 186 Calcium-binding EGF domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with higher levels in leukocytes and lymph nodes (PubMed:14673143). Expressed in radial glia neural stem cells during cortical development (PubMed:29856954). {ECO:0000269|PubMed:14673143, ECO:0000269|PubMed:29856954}.
Sequence 
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGE
DCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC
TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCD
SLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
Sequence length 236
Interactions View interactions

No strongly related genes found yet for NOTCH2NLA.

No additional diseases found yet through genes similar to NOTCH2NLA.