NME9 (NME/NM23 family member 9)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 347736
Gene name NME/NM23 family member 9
Gene symbol NME9
Synonyms (NCBI Gene)
NM23-H9NXL2TXL-2TXL2TXNDC6
Chromosome 3
Chromosome location 3q22.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004550 Function Nucleoside diphosphate kinase activity IEA
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0006183 Process GTP biosynthetic process IEA
GO:0006228 Process UTP biosynthetic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618584 21343 ENSG00000181322
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86XW9
Protein name Thioredoxin domain-containing protein 6 (Thioredoxin-like protein 2) (Txl-2)
Protein function May be a regulator of microtubule physiology.
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00085 Thioredoxin 11 → 111 Thioredoxin Domain
PF00334 NDK 159 → 300 Nucleoside diphosphate kinase Domain
Tissue specificity TISSUE SPECIFICITY: Detected at very low levels in testis, lung and brain. {ECO:0000269|PubMed:12569107}.
Sequence 
MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDL
LHFALAEADRLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVL
AEGRERKVIKDEALSDEDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIM
KIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFED
VVTTWRTVMGPRDPNVARREQPESLRAQYGTEMPFNAVHGSRDREDADRELALLFPSLKF
SDKDTEAPQGGEAEATAGPTEALCFPEDVD
Sequence length 330
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
11
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (11)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 21116278
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS — GWAS catalog 24931836
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 40962958
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS — GWAS catalog 39024449
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DYSLEXIA — GWAS catalog 36266505
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (7)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis GWASCAT_DG 24931836
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon Carcinoma Colon Carcinoma BEFREE 23311631
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 23311631 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Lymphoma Lymphoma Pubtator 33603952 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 23311631
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant tumor of colon Colonic Neoplasms BEFREE 23311631
★★★★★
★☆☆☆☆
Found in Text Mining only
Testicular Diseases Testicular disease Pubtator 33603952 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
CALN1 1 shared diseaseDyslexia 2 shared evidence sourcesGWAS catalog (Amyotrophic lateral sclerosis), GWAS catalog (Dyslexia) Related via 1 shared disease including Dyslexia — evidence mostly GWAS catalog. ZFP64 1 shared diseaseDyslexia 2 shared evidence sourcesGWAS catalog (Amyotrophic lateral sclerosis), GWAS catalog (Dyslexia) Related via 1 shared disease including Dyslexia — evidence mostly GWAS catalog. MRAS 1 shared diseaseDyslexia 2 shared evidence sourcesGWAS catalog (Amyotrophic lateral sclerosis), GWAS catalog (Dyslexia) Related via 1 shared disease including Dyslexia — evidence mostly GWAS catalog.
Astrocytoma Linked via 1 of 3 related genesCALN1 Autism Linked via 1 of 3 related genesCALN1 Central nervous system cancer Linked via 1 of 3 related genesCALN1 Corneal astigmatism Linked via 1 of 3 related genesCALN1 Glioma Linked via 1 of 3 related genesCALN1